PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_7746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family GRAS
Protein Properties Length: 563aa    MW: 61869 Da    PI: 5.8898
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_7746.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS247.84.1e-762855622279
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   +lLl+cA+a+s+++ + a +lL+ ++++++p+gd+ qRla+yf+++L+arla+ +sely++l  s+ s   +++ l+a +l+  ++ + k++++ a 
  MLOC_7746.1 285 HTLLLNCAQALSTDNRQSAIELLKGIRQHSTPKGDAGQRLAHYFANGLEARLAGRGSELYQSLLLSRIS---VADFLKANQLYMAACCCKKVAFIFAD 379
                  679************************************************************999998...************************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                  ++I +av+g++r+Hi+D++++qGlQWp Ll+ La+R++gpp++RiTg++ p++g   +  +eetg+rL++fA+ +gvpf+f+  +  + e++++e+L+
  MLOC_7746.1 380 KTICNAVAGKTRLHIVDYGLNQGLQWPGLLRMLAAREGGPPEVRITGIDLPQPGfhGAYHIEETGRRLSNFARVFGVPFKFRG-IPAKRETVRPEDLN 476
                  *****************************************************999999************************.69999********* PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                  ++p+E+l+V +  +  +l+des+  +   +rd+vL+ +++++P+v+++   + +++++sFl+rf eal +ysa fd l++++pr++
  MLOC_7746.1 477 IDPDEVLVVISLCHFRHLMDESLGFDGpsPRDQVLNNIRKMRPHVFIHGIMNGSYGATSFLTRFREALFHYSAQFDLLDTTVPRDN 562
                  **********************98876669*****************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.139258563IPR005202Transcription factor GRAS
PfamPF035141.4E-73285562IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MAATPEEFLA QQAFLARLEP PSPSLFLDLP PTPRGGGDDD DGHSSFDDMV LPYISHLLME  60
EGTEEEDHLF YLYPNHPAVL RAQQPFAQIL VDVADSASGS TSITSPSSSS DATASTAPST  120
ATASPHDALV QISPPPCTDA NGHASASPDN HGDEMAKRPS SDFFNHLLPG DPDMLNLAFL  180
KGMEDARKFL PPDTSLPPIK EGTVVGGGNA GRFKKKRDAP APEPDEGRPS KLMMPEQEER  240
KMFDEMMFRE HEICMKGTQN LTDGEPGKKG RSRKAVNDSE MVDLHTLLLN CAQALSTDNR  300
QSAIELLKGI RQHSTPKGDA GQRLAHYFAN GLEARLAGRG SELYQSLLLS RISVADFLKA  360
NQLYMAACCC KKVAFIFADK TICNAVAGKT RLHIVDYGLN QGLQWPGLLR MLAAREGGPP  420
EVRITGIDLP QPGFHGAYHI EETGRRLSNF ARVFGVPFKF RGIPAKRETV RPEDLNIDPD  480
EVLVVISLCH FRHLMDESLG FDGPSPRDQV LNNIRKMRPH VFIHGIMNGS YGATSFLTRF  540
REALFHYSAQ FDLLDTTVPR DNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-342885628277GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3672260.0AK367226.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2053C24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLF2DTK80.0F2DTK8_HORVD; Predicted protein
STRINGMLOC_7746.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.12e-96SCARECROW-like 14