PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_76271.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 363aa    MW: 38665.4 Da    PI: 8.3035
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_76271.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-12107151347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
     MLOC_76271.3 107 PWTEEEHRMFLLGLQKLGKGDWRGISRSFVVSRTPTQVASHAQKY 151
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.102.3E-4222IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.565319IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.316100156IPR017930Myb domain
SuperFamilySSF466891.35E-16102157IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-18103155IPR006447Myb domain, plants
SMARTSM007171.1E-10104154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-11104150IPR009057Homeodomain-like
CDDcd001676.07E-9107152No hitNo description
PfamPF002493.0E-10107151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNARTCPA RSGGGVRLFG VHLTSPPVAA MKKSASMSCI ASSLGGGGSG  60
GSSPAAGPGP GGVARGGGEG APGYVSDDPM HASCSTNGRA ERKKGTPWTE EEHRMFLLGL  120
QKLGKGDWRG ISRSFVVSRT PTQVASHAQK YFIRQTNFSR RKRRSSLFDM VPEMPMDESP  180
DGAEEFTLCS TQDETTNSNK LSLFHLGRPK EAECDKDLPT LQLRQHEESE YAGRLLEAPD  240
FEMNNGVSFK AASVSTVPAF YPALLPVPLT LWPANVSNVE AANATHEVLK PTPVNVKEAI  300
KADEVVSMSK LSIGGDSSSS MEPSALSLQL TGPTNTRQSA FHVSPPMTRT DLSQGNNSPI  360
HAV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3716730.0AK371673.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2139L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564624.10.0PREDICTED: uncharacterized protein LOC100828575
TrEMBLF2E6990.0F2E699_HORVD; Predicted protein
STRINGMLOC_76271.10.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.14e-70MYB_related family protein