PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_74813.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family Trihelix
Protein Properties Length: 520aa    MW: 57184.1 Da    PI: 5.1297
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_74813.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix64.62.1e-201691787
      trihelix 17 meerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87
                  m+ ++r+++lk+p Weevs+k++e g+ rs+k+Ckek+en+ k+y+++keg+ +r  ++ +++++f++lea
  MLOC_74813.2  1 MDAAFRNAALKAPVWEEVSRKLAELGYCRSAKKCKEKFENVDKYYRRTKEGRAGR--QDGKNYRFFEELEA 69
                  67899************************************************97..66678******985 PP

2trihelix106.71.6e-33258343187
      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                   rW+k+ev+aLi++r e++e+ ++  +k+plWe++s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++k+r +++s+tcpyf+ql+a
  MLOC_74813.2 258 RWPKEEVHALIQLRMEKDEHCQDMGAKGPLWEDISAGMRRIGYNRSSKRCKEKWENINKYFKKVKESNKRR-PDDSKTCPYFHQLDA 343
                   8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122036.04E-16149No hitNo description
PfamPF138373.8E-15470No hitNo description
PROSITE profilePS500904.5881542IPR017877Myb-like domain
PROSITE profilePS500907.631251315IPR017877Myb-like domain
SMARTSM007170.003255317IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-4257314IPR009057Homeodomain-like
CDDcd122032.22E-24257322No hitNo description
PfamPF138379.6E-22258344No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MDAAFRNAAL KAPVWEEVSR KLAELGYCRS AKKCKEKFEN VDKYYRRTKE GRAGRQDGKN  60
YRFFEELEAL HAAAPQHNHP MATATTILPD PRPLAMAPAY PAAGLPDLSL SSNSESESDD  120
GSDEGEDQAG GGGRSNESMM ALFEGMIKQI TEKQDATQRL FLETLEKWEA DRTAREEAWR  180
RQELARISRE REQHARERAA AAARDAALIA FLQRVGGNSV LPTPMPAPHP DAPAASLQLV  240
VAASEEGGRR ESGAGMSRWP KEEVHALIQL RMEKDEHCQD MGAKGPLWED ISAGMRRIGY  300
NRSSKRCKEK WENINKYFKK VKESNKRRPD DSKTCPYFHQ LDAIYRKKQF AVANAGGGCS  360
GTASGNTLAA VNAAASEKEN HPWRELEGKV SNDFGRRYRV GGGSSDAPPG DAEMAAASTV  420
LDAVGTSKKS EDNMQSMEPN MQSQQKELTA TDETDSDDIE TNYTDDGDDD DDGEDGNEDD  480
KMKYTIEFQK HKESGSSSAP APATVVTSSA PTSSTFLAVQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3754940.0AK375494.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3095N08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953287.11e-163PREDICTED: trihelix transcription factor GTL1-like isoform X1
RefseqXP_004953288.11e-163PREDICTED: trihelix transcription factor GTL1-like isoform X1
RefseqXP_012699251.11e-163PREDICTED: trihelix transcription factor GTL1-like isoform X1
SwissprotQ391171e-100TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLM0YZH40.0M0YZH4_HORVD; Uncharacterized protein
STRINGMLOC_74813.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.28e-53Trihelix family protein