PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_74705.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family GRAS
Protein Properties Length: 695aa    MW: 76552.5 Da    PI: 7.9264
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_74705.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS328.81e-1003106851373
          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                   l++ L++cA+av++gd +  ++lL+++++++s +gd++qRla +f+e+L+arla+++s++y++l +++ts   + e l a+kl+  +s + k+ ++ 
  MLOC_74705.1 310 LRTMLIHCAQAVATGDRRGSNELLKQIKQHSSAKGDATQRLAYCFAEGLEARLAGTGSHVYQSLMAKSTS---VGEFLRAYKLYMAASSFRKVNFIF 403
                   5789************************************************************999999...9*********************** PP

          GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                     + I++a+ g++r+Hi+D+++++G+QWp Llq La+R++gpp +RiTg++ p++g   + ++eetg+rL+k A+e+gvpf+++  +  ++e+++ e
  MLOC_74705.1 404 VGKIIMDAMVGKSRLHIVDYNVQYGFQWPGLLQMLAEREGGPPDVRITGIDLPQPGfrPAFQIEETGRRLSKCAREFGVPFKYHG-IPAKFETVHAE 499
                   *******************************************************999***************************.799******** PP

          GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                   +L+++p+E+l+V ++    +l+desv ++      +rd vL+ +++++P+v++ +  +  ++++ F++rf eal  ysa fd+l+a++pr++++r  
  MLOC_74705.1 500 DLNIDPDEVLIVTSQSGFSNLMDESVIMDRqdipsPRDMVLSNIRKMRPDVFIDCVVNGTYGAPFFVTRFREALFSYSAQFDMLDATIPRDNDDRLL 596
                   **********************99887665555669************************************************************* PP

          GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                   +Er ++g+ + nv+acega+r+ r et+++W+ r ++aG+++vpls  ++k ++  +++ + + + ++ ++ +l++gWk+r L+++S W
  MLOC_74705.1 597 IERDIFGPCALNVIACEGADRVDRPETYKQWQVRGHRAGLRQVPLSPAVVKLVRDKVKTLYHKDFLIDVDNRWLLQGWKGRVLYAMSTW 685
                   *************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.195284666IPR005202Transcription factor GRAS
PfamPF035143.6E-98310685IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 695 aa     Download sequence    Send to blast
TTVASSTFSS DSATGRSASS CSDSATNTGK STCSFHSTTN TAHSTSCSSS PGGLAPANPT  60
WPYDRIYLSQ PLHSPPYNAN NLFFSGVGTP TAGYFGHTPA LSKGNNDYFL APAGQNGRST  120
GMQSFAALSN SSAAKDAKTL SNNGGSCRGG PCTPASAFFN GQTDGDVDML NMAFRKGMEE  180
ANKFLPTTNT LDAISNKPVL RDLTGDQLKK EEVDRLRMSM FSNGRGRKNR HGAEDLEAEV  240
GRRSKLMMPE QEDTGVGEMV EEIMLHGHEI IMKGIEDLHI AMDTEAEKNH RKGASKAARG  300
RRGASEVVDL RTMLIHCAQA VATGDRRGSN ELLKQIKQHS SAKGDATQRL AYCFAEGLEA  360
RLAGTGSHVY QSLMAKSTSV GEFLRAYKLY MAASSFRKVN FIFVGKIIMD AMVGKSRLHI  420
VDYNVQYGFQ WPGLLQMLAE REGGPPDVRI TGIDLPQPGF RPAFQIEETG RRLSKCAREF  480
GVPFKYHGIP AKFETVHAED LNIDPDEVLI VTSQSGFSNL MDESVIMDRQ DIPSPRDMVL  540
SNIRKMRPDV FIDCVVNGTY GAPFFVTRFR EALFSYSAQF DMLDATIPRD NDDRLLIERD  600
IFGPCALNVI ACEGADRVDR PETYKQWQVR GHRAGLRQVP LSPAVVKLVR DKVKTLYHKD  660
FLIDVDNRWL LQGWKGRVLY AMSTWVAADH DYSKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-383146858374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3649830.0AK364983.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2030A10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
TrEMBLM0YZ700.0M0YZ70_HORVD; Uncharacterized protein
STRINGMLOC_74705.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-148GRAS family protein