PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_74460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family ERF
Protein Properties Length: 233aa    MW: 24899.2 Da    PI: 4.9136
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_74460.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP254.92.1e-174799155
           AP2  1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
                  + y+GVr++ + grWv+e+r+p ++g   r++lg++  ae Aa+a++aa+++l g
  MLOC_74460.1 47 PVYRGVRRRGSAGRWVCEVRVPGKRG--ERIWLGTYVAAESAARAHDAAMLALLG 99
                  68*******************95544..***********************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008471.9E-124799IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.108.3E-2648113IPR001471AP2/ERF domain
SMARTSM003808.6E-1748117IPR001471AP2/ERF domain
PROSITE profilePS5103220.65348111IPR001471AP2/ERF domain
SuperFamilySSF541714.9E-1648113IPR016177DNA-binding domain
CDDcd000188.14E-2049113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MDVGIDCWIS SPSSSTSGHE LGVAVPVWSP AAKRPAGRTK FKETRHPVYR GVRRRGSAGR  60
WVCEVRVPGK RGERIWLGTY VAAESAARAH DAAMLALLGR STSAAACLNF PDSAWLLVLP  120
PKLTDLADVR RAATEAVAGF LRMEAAVVPI LDEATSPVYL PSSVDNADDV FQVPAFSAQG  180
SDMFELDMSG EMDLDAYYAG FAQGMLLEPP PTPSHWENGE CGDGAAAAGL WSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0287680.0EF028768.1 Triticum aestivum CBFIIId-D19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238394.16e-81PREDICTED: dehydration-responsive element-binding protein 1H
SwissprotA2Z3894e-58DRE1A_ORYSI; Dehydration-responsive element-binding protein 1A
SwissprotQ64MA15e-58DRE1A_ORYSJ; Dehydration-responsive element-binding protein 1A
TrEMBLM0YYJ01e-170M0YYJ0_HORVD; CBF12C
STRINGMLOC_74460.11e-169(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19636261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25470.11e-32C-repeat/DRE binding factor 2