PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_73724.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family Dof
Protein Properties Length: 280aa    MW: 29884.6 Da    PI: 8.4938
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_73724.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.34.5e-403292262
        zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                  +++ lkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++s
  MLOC_73724.1 32 HDQPLKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRAS 92
                  7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-313090IPR003851Zinc finger, Dof-type
PfamPF027012.1E-333390IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3573690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGSSSPSEEL IIACPEPMQA QQAADRRLRP QHDQPLKCPR CDSTHTKFCY YNNYSLSQPR  60
YFCKTCRRYW TKGGSLRNVP VGGGCRKNKR ASAAKKPSAA AAIAPPISMM QQLHHGHSRH  120
MAETGLHLSF SGMQPPPVSA ADPLCSLGLF DWKYDHILSG SGGFESANSE AHFTGPGLMG  180
NANGNGSGGA EYHALNALRY AAGLGEHLAL PFGGATSRAE RDSTVVEMKP QAERLLSLEW  240
CGEASRAPTE TSISSLSGLG LWSGMITGAA HHHHGSSAAI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_73724.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3763880.0AK376388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122H18.
GenBankAM0843600.0AM084360.1 Hordeum vulgare subsp. vulgare dof12 gene for dof zinc finger protein 12, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020196058.11e-174dof zinc finger protein DOF1.6-like
TrEMBLA5HWG10.0A5HWG1_HORVV; Dof zinc finger protein 12
STRINGMLOC_73724.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.14e-37Dof family protein