PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_72525.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 170aa    MW: 17907.3 Da    PI: 8.5906
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_72525.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.91.7e-4338136199
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+v+vi+ lq++l+ql+++la++
  MLOC_72525.1  38 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVAVISILQRNLRQLQQDLARA 134
                   7*********************************************************************************************998 PP

        DUF260  98 ke 99 
                   k 
  MLOC_72525.1 135 KY 136
                   76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.37937138IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-4338134IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MASSSASSLP APGGSVITLA ASSAGGNGAG GVCGTGSPCA ACKFLRRKCQ PDCVFAPYFP  60
PDNPQKFVHV HRVFGASNVT KLLNELHPYQ REDAVNSLAY EADMRLRDPV YGCVAVISIL  120
QRNLRQLQQD LARAKYELSK YQSAAGPNGS QAMAEFIGSA VPNGVASFIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-54341417114LOB family transfactor Ramosa2.1
5ly0_B2e-54341417114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_72525.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3736070.0AK373607.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3036G24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194937.11e-121LOB domain-containing protein 6-like
RefseqXP_020194938.11e-121LOB domain-containing protein 6-like
SwissprotQ32SG37e-94LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLF2EBT21e-121F2EBT2_HORVV; Predicted protein
STRINGMLOC_72525.11e-122(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-56LBD family protein