PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_72280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family bHLH
Protein Properties Length: 219aa    MW: 23890.1 Da    PI: 5.7122
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_72280.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH43.94.2e-1475127155
                   CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
           HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                   ++ +hn+ Er RR+++N+ +  Lr+llP a   + kKls  +++ +A +YI +Lq
  MLOC_72280.1  75 KKLSHNAYERDRRKQLNELYLSLRSLLPDA--DHTKKLSIPTTVCRALKYIPELQ 127
                   6789*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474596.94E-1772142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.87874126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000835.32E-1174131No hitNo description
PfamPF000103.3E-1175127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.4E-1275141IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.8E-980132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MDHLLYGDPS GSSFSPLEAQ IFSGELPPSP TWPNLDLDLD LDLDVLEDDI VRELSERPAK  60
AASSGSGSGG PGSHKKLSHN AYERDRRKQL NELYLSLRSL LPDADHTKKL SIPTTVCRAL  120
KYIPELQKQV ENLEKKKEKL ASANCKPGVL SVSGSIAPTV SATCLNDKEI MVQISMSRDK  180
DAATTLPLSK CINVLENEGL QLISSSTSST FGNKMFYNL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA motif 5'-CACGTGG-3' in the promoter of iron (Fe) deficiency-inducible genes as well as of genes involved in iron homeostasis, thus contributing to basal tolerance to iron deficiency, iron uptake from soil and iron transport, particularly during seed maturation and germination. Promotes the accumulation of mugineic acid family phytosiderophores (MAs). Required for ethylene-mediated signaling during iron deficiency responses. Improves growth and yield, especially in calcareous soil with low iron availability. Promotes iron concentration in shoots and grain. {ECO:0000250|UniProtKB:Q0JFZ0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_72280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3624260.0AK362426.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2005A04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020153147.11e-123transcription factor bHLH100-like
SwissprotA2WZ602e-74IRO2_ORYSI; Protein IRON-RELATED TRANSCRIPTION FACTOR 2
TrEMBLA0A287JI271e-158A0A287JI27_HORVV; Uncharacterized protein
STRINGMLOC_72280.11e-159(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.19e-27bHLH family protein