PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_72280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family bHLH
Protein Properties Length: 219aa    MW: 23890.1 Da    PI: 5.7122
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_72280.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH43.94.2e-1475127155
                   CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
           HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                   ++ +hn+ Er RR+++N+ +  Lr+llP a   + kKls  +++ +A +YI +Lq
  MLOC_72280.1  75 KKLSHNAYERDRRKQLNELYLSLRSLLPDA--DHTKKLSIPTTVCRALKYIPELQ 127
                   6789*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474596.94E-1772142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.87874126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000835.32E-1174131No hitNo description
PfamPF000103.3E-1175127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.4E-1275141IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.8E-980132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MDHLLYGDPS GSSFSPLEAQ IFSGELPPSP TWPNLDLDLD LDLDVLEDDI VRELSERPAK  60
AASSGSGSGG PGSHKKLSHN AYERDRRKQL NELYLSLRSL LPDADHTKKL SIPTTVCRAL  120
KYIPELQKQV ENLEKKKEKL ASANCKPGVL SVSGSIAPTV SATCLNDKEI MVQISMSRDK  180
DAATTLPLSK CINVLENEGL QLISSSTSST FGNKMFYNL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3624260.0AK362426.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2005A04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971295.17e-82PREDICTED: transcription factor ORG3-like
RefseqXP_008656862.14e-82PREDICTED: transcription factor ORG3-like
TrEMBLM0YS741e-160M0YS74_HORVD; Uncharacterized protein
STRINGMLOC_72280.11e-159(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.19e-27bHLH family protein