PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_72117.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family GRAS
Protein Properties Length: 622aa    MW: 65692 Da    PI: 6.8306
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_72117.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2974.8e-912556222374
          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                   ++lL e+A a+++g++e a a La+l+  a+p+gd+ +Rl+a+++  L++r++       ++ ++++ ++  s+e+ +  +l+++++P+++++  +a
  MLOC_72117.1 255 RQLLSEAAVAIADGNFETAAANLATLKRAANPRGDAEHRLVAMMVAVLSSRIVP-----TASASSQHLADLCSAEHHTGCQLLHDITPCFRLALDAA 346
                   689**************************************************9.....3333444444445889999999**************** PP

          GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                   N aI+eav+g+++vH +Dfdi+ + Q + L+q La+R+ +  sl++T+v +p+s      + +l  +gerL+k+Ae+ g++ +f++ v+ r +++e 
  MLOC_72117.1 347 NIAIVEAVAGHRAVHLVDFDINAP-QHAILIQRLADRRVPGTSLQVTAVTDPTSPftqsLTATLPGVGERLKKLAERAGIEYSFRI-VSCRAAEIEA 441
                   *********************987.99************************9988777667788899******************9.7999****** PP

          GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                   ++L ++pgEalaVnl+++l +++desvs +++rde+L+ v+ l P++v++veqe++ n++++++rf++a+ +y a++dsl+++++res +r+  E++
  MLOC_72117.1 442 SKLGCEPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALGPQIVTLVEQELNSNTAPLATRFSDACLHYGAILDSLDSTVSRESADRARAEEA 538
                   ************************************************************************************************* PP

          GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +++   n+v  ega+r er+e ++kWr+r+++aGF+pv+l   +a+q+ + +   +  g  v+ e+g l lgWk+r ++++SaWr
  MLOC_72117.1 539 -VANMSANAVGREGADRLERCEVFGKWRARFGMAGFRPVALAAGIADQVMARVGAPP-PGLVVKPENGVLRLGWKGRVVTVASAWR 622
                   .777889**********************************************9999.9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.503228603IPR005202Transcription factor GRAS
PfamPF035141.7E-88255622IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MEPGGPWRDP RQGYVYGLGS PMQMPAQQRS DPAAVGGVLK RSLGEIERWQ HHRLQQELYM  60
RAVRQRTVGT SPDFAAVFGG VPSQPFFSGS SLGGGLASPS STLSSLTTAS RAAMPLIQQH  120
VHRQAPFVPS SAHAQPQAQA QAHALAVGRE PTPSAVGSEL SILQDLEKQL LGDDDEAEPA  180
MSGTGSTVTS SEWEETIQRL NSITAAPSPP LYAEATPNNK NNYSAAMTGS PSNSSTSTAS  240
SSASCSPPIS ATTSRQLLSE AAVAIADGNF ETAAANLATL KRAANPRGDA EHRLVAMMVA  300
VLSSRIVPTA SASSQHLADL CSAEHHTGCQ LLHDITPCFR LALDAANIAI VEAVAGHRAV  360
HLVDFDINAP QHAILIQRLA DRRVPGTSLQ VTAVTDPTSP FTQSLTATLP GVGERLKKLA  420
ERAGIEYSFR IVSCRAAEIE ASKLGCEPGE ALAVNLAFAL SHVPDESVSP ANPRDELLRR  480
VRALGPQIVT LVEQELNSNT APLATRFSDA CLHYGAILDS LDSTVSRESA DRARAEEAVA  540
NMSANAVGRE GADRLERCEV FGKWRARFGM AGFRPVALAA GIADQVMARV GAPPPGLVVK  600
PENGVLRLGW KGRVVTVASA WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-362506221375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLM0YRP70.0M0YRP7_HORVD; Uncharacterized protein
STRINGMLOC_72117.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-84SCARECROW-like 8