PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_71592.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family bHLH
Protein Properties Length: 285aa    MW: 30746.3 Da    PI: 5.6279
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_71592.5genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH33.76.5e-11240281344
                   HHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHH CS
           HLH   3 rahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiL 44 
                   + hn  ErrRRdriN+++  L+el+P++ k ++  ls a++L
  MLOC_71592.5 240 QVHNLSERRRRDRINEKMRALQELVPHCNKVRNSNLSAASVL 281
                   56*************************977777778888777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000833.90E-9234283No hitNo description
SuperFamilySSF474591.2E-10235282IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.814237285IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.3E-11240282IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.5E-8240282IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MNQQFVPADW SGNMGDALPP LSGEDGGLVE LLRCSGHVVM QSQAVRELEA TPWFQYPIDD  60
SLEEKDLFSE IFGRMPADGA GTPWKEEDQE RGAADAVTAL RSVLMPPPLL LTDKAGLHGH  120
GPPVSEAGES SVVTMAFGRP CGGSNEAQTP HVSDAAGDDR VLLPLSSKEA RDARSYHSAS  180
ATLTTSSAWS RPSGASKRKQ CDGAESPGEV MQHDVESESA NVTCETAQKP ATAKRRRAAQ  240
VHNLSERRRR DRINEKMRAL QELVPHCNKV RNSNLSAASV LNLLI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1234249RRRAAQVHNLSERRRR
2245250ERRRRD
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_71592.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3609630.0AK360963.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1129K08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020189473.11e-126transcription factor PIF4-like
TrEMBLM0YQ180.0M0YQ18_HORVV; Uncharacterized protein
STRINGMLOC_71592.30.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09530.24e-16phytochrome interacting factor 3