PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_71555.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family HD-ZIP
Protein Properties Length: 317aa    MW: 35067.7 Da    PI: 4.632
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_71555.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-1965116556
                   SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   +++  eq+++Le+ Fe +++++ e+++++A+ lgL  rqV vWFqNrRa++k
  MLOC_71555.2  65 RRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWK 116
                   467789*********************************************9 PP

2HD-ZIP_I/II128.92.1e-4163154293
   HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                   kkrrl+ eqv++LE+sFe+++kL+perK+++ar+Lgl+prqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++e
  MLOC_71555.2  63 KKRRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWKTKQLERDFNALRARHDALRADCDALRRDKDALAAEIHE 154
                   9**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.9E-1961122IPR001356Homeobox domain
SuperFamilySSF466892.04E-1861120IPR009057Homeodomain-like
CDDcd000864.30E-1763119No hitNo description
PROSITE profilePS5007116.55263118IPR001356Homeobox domain
PfamPF000468.9E-1765116IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-1970117IPR009057Homeodomain-like
PRINTSPR000314.4E-58998IPR000047Helix-turn-helix motif
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
PRINTSPR000314.4E-598114IPR000047Helix-turn-helix motif
PfamPF021832.9E-16118159IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MKRQIKRPAG SKESPEPGEK LAFAEKENLL AAYMDHEEPE LEEADEEEEE EEERAMSCGL  60
GGKKRRLALE QVRALERSFE TDNKLDPERK ARIARDLGLH PRQVAVWFQN RRARWKTKQL  120
ERDFNALRAR HDALRADCDA LRRDKDALAA EIHELREKLS TKPETAVKAE ATGNVEAAEE  180
RLQQATMVGA AVCKDGSSDS DSSAVFNDEA SPYSGAVFEQ QGFMGFGASF LDTASAAAAT  240
TGCTSLPMLE PKWPSAYPYD ASRSSAYGFT EEWLSGSDAI GNDGSSAFFS EEHVSNLNFG  300
WCSSGAEGFD LQSYCKK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110118RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_71555.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3539650.0AK353965.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1004B20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190062.10.0homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-109HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLF2CQR30.0F2CQR3_HORVV; Predicted protein
STRINGMLOC_71555.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-32homeobox 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]