PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_70549.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family Trihelix
Protein Properties Length: 276aa    MW: 29779.4 Da    PI: 10.4054
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_70549.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix109.52.2e-3459144187
      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                   rW+k ev+aLi++r+eme r+++++ k+plWe++s  mr+ g++rs+k+Ckekwen+nk++kk+ke+++kr +e+s+tcpyf+ql+a
  MLOC_70549.3  59 RWPKAEVHALIQLRTEMEARYQDTAPKGPLWEDISVGMRRLGYNRSSKRCKEKWENINKYFKKVKESSRKR-PEDSKTCPYFHQLDA 144
                   8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.13158116IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.6E-458115IPR009057Homeodomain-like
CDDcd122035.34E-3458123No hitNo description
PfamPF138371.6E-2359145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MRTQPQTPQP QQHVTPTATP EPQPQTPQQQ PHHQQSKEIV VHAPEQPPVD MAGGASPSRW  60
PKAEVHALIQ LRTEMEARYQ DTAPKGPLWE DISVGMRRLG YNRSSKRCKE KWENINKYFK  120
KVKESSRKRP EDSKTCPYFH QLDALYRTKA LAVGSSSSSS SGVHAPALQA PAPSSARAEP  180
AAVTVLAPVP LSSQTPSPAA QHVEHAAKNL ISNGNGHGNG AAMQVKASNG APPTVAMFPS  240
SAQAAGNGAN SGTATNKLVR NSRPMHAHTH CQFQPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3578230.0AK357823.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1062I19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986012.11e-69PREDICTED: trihelix transcription factor GTL1-like isoform X1
RefseqXP_004986013.19e-70PREDICTED: trihelix transcription factor GTL1-like isoform X2
TrEMBLM0YLK50.0M0YLK5_HORVD; Uncharacterized protein
STRINGMLOC_70549.11e-150(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.17e-52Trihelix family protein