PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_70549.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family Trihelix
Protein Properties Length: 941aa    MW: 101037 Da    PI: 8.1717
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_70549.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.32.5e-29287371187
      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                   rW++qe+laL+++r+em+ ++r+++lk+plWeevs++++e g +rs+k+C+ek+en+ k+y+++k+g+ +r  ++ +t+++f++lea
  MLOC_70549.1 287 RWPRQETLALLKIRSEMDAAFREAALKGPLWEEVSRRLAEMGHTRSAKKCREKFENVDKYYRRTKDGRTGR--GDGKTYRFFTELEA 371
                   8********************************************************************97..77778******985 PP

2trihelix106.81.5e-33662747187
      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                   rW+k ev+aLi++r+eme r+++++ k+plWe++s  mr+ g++rs+k+Ckekwen+nk++kk+ke+++kr +e+s+tcpyf+ql+a
  MLOC_70549.1 662 RWPKAEVHALIQLRTEMEARYQDTAPKGPLWEDISVGMRRLGYNRSSKRCKEKWENINKYFKKVKESSRKR-PEDSKTCPYFHQLDA 747
                   8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0012284346IPR001005SANT/Myb domain
CDDcd122033.34E-27286351No hitNo description
PROSITE profilePS500906.899286344IPR017877Myb-like domain
PfamPF138373.7E-20286372No hitNo description
SMARTSM007170.023659721IPR001005SANT/Myb domain
CDDcd122039.69E-32661726No hitNo description
PROSITE profilePS500907.131661719IPR017877Myb-like domain
PfamPF138371.1E-22662748No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 941 aa     Download sequence    Send to blast
MCEKKTRPRV TFLTARAPTP SLSLSYHLLE GVHHLLRTHL SLSHRPSPFL PPQPPPAPGT  60
PPFSSSSTAI FILLFSAHLP PATVRTTLSS SSSCVTAPQP QHNPHPHLSL SPSPSPCQPS  120
LATQRPKPLL ISLPLLALLL LPPPPFSSPL PPLSFQVYSP VAAAAQPLHA CTAHGSAASL  180
PQHHPPNNPP LTTKQSCSIP LCGAMQQPPD MPPFSPAGWR GPAGAPSPIS SRPPAPTPAP  240
APGQQHQQHQ MDEQHGAAVS GSGSGSVDGG EEGERGGSSS AAPGGNRWPR QETLALLKIR  300
SEMDAAFREA ALKGPLWEEV SRRLAEMGHT RSAKKCREKF ENVDKYYRRT KDGRTGRGDG  360
KTYRFFTELE ALHGAHQPPP AAPVSATIVT YSAVPTAPPR VLQAAEPSPP PLFLTHQPVP  420
TESPACLTTT APVGDASFSD SDGEDTDETA DGGKRKRRGG SWGHGGKAMR FFEGLMRQVM  480
ERQEAMQSRL LEAIERRDQD RMIREEAWRR QEVARLAREQ DALAQERAVA ASRDAAVVSF  540
IQRITGQIVP VQAPSSFPAK PAATVTSVKP PPLQPTPVAS AAPAPAPPTP RPPVQAQPNV  600
TTPMRTQPQT PQPQQHVTPT ATPEPQPQTP QQQPHHQQSK EIVVHAPEQP PVDMAGGASP  660
SRWPKAEVHA LIQLRTEMEA RYQDTAPKGP LWEDISVGMR RLGYNRSSKR CKEKWENINK  720
YFKKVKESSR KRPEDSKTCP YFHQLDALYR TKALAVGSSS SSSSGVHAPA LQAPAPSSAR  780
AEPAAVTVLA PVPLSSQTPS PAAQHVEHAA KNLISNGNGH GNGAAMQVKA SNGAPPTVAM  840
FPSSAQAAGN GANSGTATNK LELKQEGVAK ETAPVVQPAV AMNHSYGRND RRDVYDLDSD  900
SMDEDDEDDF DDDDDEEDDD VPGGRNINMP PVLHQYDAHF L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3578230.0AK357823.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1062I19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986012.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X1
TrEMBLM0YLK30.0M0YLK3_HORVD; Uncharacterized protein
STRINGMLOC_70549.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.16e-48Trihelix family protein