PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_68772.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 76aa    MW: 8876.08 Da    PI: 10.0285
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_68772.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.77.3e-103170445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T+ E++l  + +++ G++ W++Ia +++ gRt++++  +w 
     MLOC_68772.1 31 FTEAEEDLVFRMHRLVGNR-WELIAGRIP-GRTAEEVEMFWA 70
                     9******************.*********.*******98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.2722376IPR017930Myb domain
SMARTSM007171.7E-72775IPR001005SANT/Myb domain
PfamPF002496.3E-93170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-123171IPR009057Homeodomain-like
CDDcd001672.79E-73169No hitNo description
SuperFamilySSF466896.63E-93172IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010026Biological Processtrichome differentiation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048765Biological Processroot hair cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MSSKSLGKNS KIMSGRERKE VNSNAKHFVD FTEAEEDLVF RMHRLVGNRW ELIAGRIPGR  60
TAEEVEMFWA KKHQDQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3708511e-126AK370851.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2118H15.
GenBankAK2488361e-126AK248836.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf6c21, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458170.14e-34hypothetical protein SORBIDRAFT_03g028170
SwissprotB3H4X81e-19TCL2_ARATH; MYB-like transcription factor TCL2
TrEMBLF2E3X71e-50F2E3X7_HORVD; Predicted protein
STRINGMLOC_68772.14e-50(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52753157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01060.13e-22CAPRICE-like MYB3