PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_68570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 215aa    MW: 22006.9 Da    PI: 6.6104
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_68570.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601345.8e-42321311100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrr+C++ Cvlapyfp ++p+kfa +h++FGasn++kll++lpee+r da+ss+vyeA arardPvyG++g i +lq+q++ lka+la++
  MLOC_68570.1  32 PCAACKILRRRCVDRCVLAPYFPPTDPHKFATAHRVFGASNIIKLLQDLPEEQRADAVSSMVYEAAARARDPVYGSAGAICQLQRQVDGLKAQLARA 128
                   7**********************************************************************************************99 PP

        DUF260  98 kee 100
                   ++e
  MLOC_68570.1 129 QAE 131
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.0231132IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4132129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MESSGDTAPL HSSPTPTSPP AMATGTAVVM SPCAACKILR RRCVDRCVLA PYFPPTDPHK  60
FATAHRVFGA SNIIKLLQDL PEEQRADAVS SMVYEAAARA RDPVYGSAGA ICQLQRQVDG  120
LKAQLARAQA ELAAARAHHA HLVALLCVEV ATAAATPPQD AYCSGGGGSQ SQLAAPPGVG  180
SAPADALYVV DGSAAGGGGI MQAGHVGWAD EPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-413113210111LOB family transfactor Ramosa2.1
5ly0_B4e-413113210111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_68570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020176565.11e-134LOB domain-containing protein 1-like
SwissprotQ9LQR02e-58LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM0YEU31e-153M0YEU3_HORVV; Uncharacterized protein
STRINGMLOC_68570.11e-153(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-52LOB domain-containing protein 1