PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_68189.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 164aa    MW: 18330 Da    PI: 10.5241
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_68189.8genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445e-143579147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
     MLOC_68189.8 35 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 79
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.84E-172985IPR009057Homeodomain-like
PROSITE profilePS5129415.4083084IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-73385IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-193382IPR006447Myb domain, plants
SMARTSM007175.3E-113482IPR001005SANT/Myb domain
PfamPF002498.6E-123579IPR001005SANT/Myb domain
CDDcd001672.23E-93780No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MVSTNPPPPP ALSDAAAGDD ASKKVRKPYT ITKSRESWTE QEHDKFLEAL QLFDRDWKKI  60
EAFVGSKTVI QIRSHAQKYF LKVQKNGTSE HVPPPRPKRK AAHPYPQKAS KNEPGYALKT  120
DPSAMLRNSG MNVAVSSWTH NSIPPVVASS FMKGLYSKVP LLYK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3585100.0AK358510.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1077K09.
GenBankAK3548340.0AK354834.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1011N06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235824.13e-97PREDICTED: protein REVEILLE 6 isoform X2
SwissprotQ8RWU35e-64RVE8_ARATH; Protein REVEILLE 8
TrEMBLM0YDL41e-119M0YDL4_HORVD; Uncharacterized protein
STRINGMLOC_68189.31e-109(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.22e-48MYB_related family protein