PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_68189.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 259aa    MW: 28773.6 Da    PI: 9.508
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_68189.4genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-133579147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
     MLOC_68189.4 35 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 79
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.88E-172985IPR009057Homeodomain-like
PROSITE profilePS5129415.4083084IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-73385IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-183382IPR006447Myb domain, plants
SMARTSM007175.3E-113482IPR001005SANT/Myb domain
PfamPF002491.9E-113579IPR001005SANT/Myb domain
CDDcd001671.10E-83780No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MVSTNPPPPP ALSDAAAGDD ASKKVRKPYT ITKSRESWTE QEHDKFLEAL QLFDRDWKKI  60
EAFVGSKTVI QIRSHAQKYF LKVQKNGTSE HVPPPRPKRK AAHPYPQKAS KNEPGYALKT  120
DPSAMLRNSG MNVAVSSWTH NSIPPVVASS FMKEDLGAGS MGPNIFCSSS SEGPPRAWQS  180
GETNDQINQV PSLRIMPDFA QVYSFLGSVF DPNTKGHLQK LKEMNPIDVE TALLLMRNLS  240
INLTSPDFED QVSSYPTFR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3548340.0AK354834.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1011N06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570106.11e-171PREDICTED: protein REVEILLE 6 isoform X1
SwissprotQ8H0W33e-97RVE6_ARATH; Protein REVEILLE 6
TrEMBLM0YDL30.0M0YDL3_HORVD; Uncharacterized protein
STRINGMLOC_68189.30.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.13e-84MYB_related family protein