PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_61814.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family Trihelix
Protein Properties Length: 298aa    MW: 32555.3 Da    PI: 6.799
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_61814.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix66.36.5e-212392172
      trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrt 72
                  rWt++e+l+Li+a+r +e+r  +      +W+ vs+++r++g+er+p qC+++w nl+++ kki ++ekk++
  MLOC_61814.1 23 RWTRHETLVLIQAKRVTEQRAAQ--PVRLKWAVVSAYCRRHGVERGPMQCRKRWGNLSWDLKKIVAWEKKHA 92
                  8****************998655..5899****************************************984 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.761678IPR017877Myb-like domain
SuperFamilySSF466897.44E-52080IPR009057Homeodomain-like
PfamPF138374.2E-92391No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0050777Biological Processnegative regulation of immune response
GO:0071219Biological Processcellular response to molecule of bacterial origin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MMSANGDSPA GAAVTTPRSR LPRWTRHETL VLIQAKRVTE QRAAQPVRLK WAVVSAYCRR  60
HGVERGPMQC RKRWGNLSWD LKKIVAWEKK HAAALAAGDA DSTAPERESF WDMRGEQRRA  120
RQLPSSFDRE VYDAIVGAGA ANQLRPDSAE EMELADDADE HPPSPMMVMP IQARMYVPPA  180
SSQSQHECSD PATESAKKPA SDKNSTSQQD SEATFGAGVG AEDTDTATAT ATATPTAEAG  240
TTSMGRQVTE ALERGNRLLA EQLEAQRANW DADREHRRAL LAAVNKLADA AARIAERL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00288DAPTransfer from AT2G33550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567424.31e-127PREDICTED: trihelix transcription factor ASR3-like isoform X1
TrEMBLM0XP670.0M0XP67_HORVD; Uncharacterized protein
STRINGMLOC_61814.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139722224
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.15e-38Trihelix family protein