PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_61156.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 261aa    MW: 26841.1 Da    PI: 7.7954
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_61156.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.55.4e-4436134199
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+++la++
  MLOC_61156.1  36 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELNPYQREDAVNSLAYEADMRLRDPVYGCVGVISVLQHQLRQLQQDLARA 132
                   7*********************************************************************************************998 PP

        DUF260  98 ke 99 
                   + 
  MLOC_61156.1 133 RY 134
                   75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.85135136IPR004883Lateral organ boundaries, LOB
PfamPF031955.7E-4436132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MASSSASSFP GSVITMASSA AAAGAASSGA AGTGSPCAAC KFLRRKCQPD CVFAPYFPPD  60
NPQKFVHVHR VFGASNVTKL LNELNPYQRE DAVNSLAYEA DMRLRDPVYG CVGVISVLQH  120
QLRQLQQDLA RARYELSKYQ AAAAVAVSAS VGCNGTPAMA DFIGNTVPNC TQNFINISHS  180
TAIGAGLGFG HDQFAAVQML ARSYEGEGAV ARLGVNGGSG GGYDFGYTSG MGPVSGLGPL  240
GGGPFLKHGT AGGDERHTAA Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-55261391114LOB family transfactor Ramosa2.1
5ly0_B6e-55261391114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_61156.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7955601e-127AY795560.1 Triticum aestivum AS2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020187374.11e-147LOB domain-containing protein 6-like
RefseqXP_020194956.11e-147LOB domain-containing protein 6-like
SwissprotQ32SG31e-116LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLM0XLP70.0M0XLP7_HORVV; Uncharacterized protein
STRINGMLOC_61156.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.46e-51LBD family protein