PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_59912.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 148aa    MW: 16522.9 Da    PI: 10.6988
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_59912.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66e-1880124147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rW++eE+e+++da  ++G + Wk+I +++  ++t+ q++s+ qky
     MLOC_59912.1  80 RERWSPEEHERFLDALLRFGRD-WKKIEEHVR-TKTAVQIRSHAQKY 124
                      78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.96E-1874130IPR009057Homeodomain-like
PROSITE profilePS5129418.96375129IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-1078131IPR009057Homeodomain-like
SMARTSM007171.0E-1179127IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.2E-1779127IPR006447Myb domain, plants
PfamPF002495.8E-1580124IPR001005SANT/Myb domain
CDDcd001678.19E-1082125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MGSRGAACVY IYVRGCRASL GIESDERLAS AREDRPSLLA CLLAGSWSIM AERGGGGEGE  60
GTSSSPGKKA RKPYTITRPR ERWSPEEHER FLDALLRFGR DWKKIEEHVR TKTAVQIRSH  120
AQKYFLKVQR LGLAAGLPPP QHPSRRHA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227459.11e-44PREDICTED: protein REVEILLE 5-like
SwissprotQ8RWU36e-31RVE8_ARATH; Protein REVEILLE 8
TrEMBLM0XGU11e-105M0XGU1_HORVD; Uncharacterized protein
STRINGMLOC_59912.11e-104(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-31MYB_related family protein