PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_59663.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 46aa    MW: 5294.11 Da    PI: 8.9311
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_59663.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.91.7e-111445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g W++eEde+l + ++++G g+W+++++  g
     MLOC_59663.3 14 KGLWSPEEDEKLMNHITKHGHGCWSSVPKLAG 45
                     688*************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-16643IPR009057Homeodomain-like
SuperFamilySSF466897.18E-10744IPR009057Homeodomain-like
PROSITE profilePS5129414.995946IPR017930Myb domain
PfamPF002499.0E-91445IPR001005SANT/Myb domain
CDDcd001671.65E-51745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 46 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSSV PKLAGE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2507331e-68AK250733.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf88d11, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001303169.12e-26transcription repressor MYB6-like
RefseqXP_006423960.13e-26hypothetical protein CICLE_v10028398mg
SwissprotQ8LPH64e-26MYB86_ARATH; Transcription factor MYB86
TrEMBLM0XFV58e-28M0XFV5_HORVD; Uncharacterized protein
STRINGGRMZM2G171781_P012e-25(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.12e-27myb domain protein 50