PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_57684.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 462aa    MW: 50241.5 Da    PI: 6.4589
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_57684.5genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.7e-172569147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT eE+e++++a k++G   W+ I +++g ++t+ q++s+ qk+
     MLOC_57684.5 25 REKWTDEEHEKFLEALKLYGRS-WRQIQEHIG-TKTAVQIRSHAQKF 69
                     789*****************55.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.95E-161973IPR009057Homeodomain-like
PROSITE profilePS5129421.6622074IPR017930Myb domain
TIGRFAMsTIGR015571.3E-152372IPR006447Myb domain, plants
SMARTSM007173.2E-142472IPR001005SANT/Myb domain
PfamPF002493.4E-142568IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-102565IPR009057Homeodomain-like
CDDcd001673.52E-112770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MQPNEEGMGE HPVKPRKPYT ITKQREKWTD EEHEKFLEAL KLYGRSWRQI QEHIGTKTAV  60
QIRSHAQKFF SKVVREPGAK IEIEIPPPRP KRKPLHPYPR KRADSCNGAN PANGPSKLAQ  120
ISSSSGSDQE NGSPVSVLSA MQSDAFGSSM SNPSSRSTSP ESSDEENNVP PMVSREEGQQ  180
TGINQSHKEA DQENKDTGTS EEDSSDEVQV TSVKLFGKTV VIPDPRKRCS PDPGSGHENG  240
GQTSHSSNKG TSQAPLAVEI PTHTKGEQIS QSSNKATSQA PLAVEVPTYT KGEQISQFSN  300
KATSQAPLAV EIPAFAAPPS GWVLPYNSFP LHFGESAEAR ITPLHMWWPY YGFPISHPGG  360
LSVVPHNEAT DESEAAKSPL VESSSKSLPV ESSSDSDDNA ETTANKEWKV LESLGTAQVP  420
RSASSFQLKP SENSAFVRVK PIIGSGEEPA RGFVPYKRCR VE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2494140.0AK249414.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf26b24, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563237.10.0PREDICTED: protein REVEILLE 1-like isoform X1
RefseqXP_010239468.10.0PREDICTED: protein REVEILLE 2-like isoform X2
SwissprotF4K5X64e-46RVE2_ARATH; Protein REVEILLE 2
TrEMBLM0X7P40.0M0X7P4_HORVD; Uncharacterized protein
STRINGMLOC_57684.20.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.15e-37MYB_related family protein