PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_57684.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 491aa    MW: 53172.8 Da    PI: 6.0787
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_57684.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-165498147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT eE+e++++a k++G   W+ I +++g ++t+ q++s+ qk+
     MLOC_57684.2 54 REKWTDEEHEKFLEALKLYGRS-WRQIQEHIG-TKTAVQIRSHAQKF 98
                     789*****************55.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.48E-1648102IPR009057Homeodomain-like
PROSITE profilePS5129421.66249103IPR017930Myb domain
TIGRFAMsTIGR015571.4E-1552101IPR006447Myb domain, plants
SMARTSM007173.2E-1453101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-105494IPR009057Homeodomain-like
PfamPF002493.7E-145497IPR001005SANT/Myb domain
CDDcd001673.98E-115699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MASMALAEET DALDSSRLPN GKGLSVDVAM QPNEEGMGEH PVKPRKPYTI TKQREKWTDE  60
EHEKFLEALK LYGRSWRQIQ EHIGTKTAVQ IRSHAQKFFS KVVREPGAKI EIEIPPPRPK  120
RKPLHPYPRK RADSCNGANP ANGPSKLAQI SSSSGSDQEN GSPVSVLSAM QSDAFGSSMS  180
NPSSRSTSPE SSDEENNVPP MVSREEGQQT GINQSHKEAD QENKDTGTSE EDSSDEVQVT  240
SVKLFGKTVV IPDPRKRCSP DPGSGHENGG QTSHSSNKGT SQAPLAVEIP THTKGEQISQ  300
SSNKATSQAP LAVEVPTYTK GEQISQFSNK ATSQAPLAVE IPAFAAPPSG WVLPYNSFPL  360
HFGESAEARI TPLHMWWPYY GFPISHPGGL SVVPHNEATD ESEAAKSPLV ESSSKSLPVE  420
SSSDSDDNAE TTANKEWKVL ESLGTAQVPR SASSFQLKPS ENSAFVRVKP IIGSGEEPAR  480
GFVPYKRCRV E
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2494140.0AK249414.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf26b24, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563237.10.0PREDICTED: protein REVEILLE 1-like isoform X1
TrEMBLM0X7P40.0M0X7P4_HORVD; Uncharacterized protein
STRINGMLOC_57684.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77833647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.17e-37MYB_related family protein