PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_5739.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB
Protein Properties Length: 960aa    MW: 106353 Da    PI: 9.3997
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_5739.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.29.3e-14444488248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT+eEd++l+ av+ +G + W ++++ +  gR ++qc +rw+k l
      MLOC_5739.1 444 RTWTKEEDLQLIAAVQAFGCN-WQLVSANLA-GRIGNQCSNRWRKTL 488
                      68*****************88.*********.************975 PP

2Myb_DNA-binding44.14.9e-14496541248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      grW+++Ed++l+  vk + +g+W++Ia+ ++ gRt  qc +rw+++l
      MLOC_5739.1 496 GRWSEDEDKRLLVSVKIFRSGSWNKIAQFVP-GRTQSQCGERWRNVL 541
                      8******************************.************986 PP

3Myb_DNA-binding35.52.3e-11548592247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g W +eEd +l+  v++ G+  W++Ia  m  +Rt+++c  rw k+
      MLOC_5739.1 548 GEWRPEEDSKLLASVHEVGPC-WSKIAGAMIPHRTDNNCLRRWKKL 592
                      79*****************88.*****99999***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.947286384IPR017877Myb-like domain
SMARTSM007170.051290386IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-10292309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-10356397IPR009057Homeodomain-like
SuperFamilySSF466891.32E-9365421IPR009057Homeodomain-like
PROSITE profilePS500907.991385437IPR017877Myb-like domain
SMARTSM007170.063389439IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-11398443IPR009057Homeodomain-like
SuperFamilySSF466891.79E-19423488IPR009057Homeodomain-like
PROSITE profilePS5129421.444438492IPR017930Myb domain
SMARTSM007173.0E-13442490IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-16444488IPR009057Homeodomain-like
PfamPF002493.1E-12444487IPR001005SANT/Myb domain
CDDcd001676.42E-10445488No hitNo description
Gene3DG3DSA:1.10.10.604.0E-18491543IPR009057Homeodomain-like
SuperFamilySSF466891.06E-24492589IPR009057Homeodomain-like
PROSITE profilePS5129410.666493541IPR017930Myb domain
SMARTSM007174.4E-12494543IPR001005SANT/Myb domain
PfamPF002491.9E-13496541IPR001005SANT/Myb domain
CDDcd001674.08E-11497541No hitNo description
PROSITE profilePS5129417.211542597IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-15544596IPR009057Homeodomain-like
SMARTSM007175.7E-10546595IPR001005SANT/Myb domain
PfamPF002492.1E-9548592IPR001005SANT/Myb domain
CDDcd001671.40E-8549592No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 960 aa     Download sequence    Send to blast
MDFYSDDDDW DAEFDEGLQE DLDLVRRSCI TAGADPDAAV AQASSYLAAP ARTTTAAAAA  60
TDGVSDEGEG EEDEDLALVR SIRENLHLNK ASPSSPRPIC AWPPSDAEDD EEDDLETLRA  120
VQRRFSHYHS GTSTGPLENM KNEASKGGDD EFIAHRPGEE GVQKKNTNAN TQTGFPKAAL  180
LLVDALKKNR ACQKFIRGKM INIEAKIEVN KDLRDRVKCL MDYQVSCRRS FGKDLCQKVD  240
PRVRLISSQK QRAQSTKKKY KMPALLLGPA ENPHVEKYKA VLKQFPVSLQ KHPWSDIEKD  300
RLAKGIKQQY QEALIKDSMK NGSSSGDFSA VDMAYALKNT LGNFEATPEV LRSVLPLVNW  360
DYIAAMYLPG RSGAECESRW LNHDDPLINQ NAWAACEEKR LILTVQEKGM HNWINIAVAL  420
GTQRTPFQCL ARYQRSLNPH ILKRTWTKEE DLQLIAAVQA FGCNWQLVSA NLAGRIGNQC  480
SNRWRKTLIP ERKRVGRWSE DEDKRLLVSV KIFRSGSWNK IAQFVPGRTQ SQCGERWRNV  540
LDPDIDHGEW RPEEDSKLLA SVHEVGPCWS KIAGAMIPHR TDNNCLRRWK KLCQNELPLI  600
IAAKQVKKAI FQTNFVDRET ERPAICPSDF PSLVYSKVDK GDENTMSDQV KKPRKRPRKS  660
CVDNVPPSDP SQSSADAAAV NTTKRKSRKK SSGIGAENQT GEVITVPDGV NNSSRGHSKA  720
RKRKVTTDGD VVVQKRMRGS ISVDNELALD ILGGPISFDN EAPTNRKGDP TSVGKEGTAK  780
KRTRGPVSVG KEGAVKKKMR GSISIGDERA VKNRMRGSVS IDNQGNTMKR KRVSRKSAKG  840
NSTIDAGVNA CELDLPSMPS EASAERGIDT GNTNKMKRKS TPRPKQINMA EGTVDEYSRL  900
VDCISFARGN GASKNNSAMP FNNAMQSDGP SVENLQVAIS ARPDPTSVEN SSSPKTKVVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-223636143155MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-223636143155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1649656VKKPRKRP
2650658KKPRKRPRK
3651657KPRKRPR
4778784AKKRTRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3685540.0AK368554.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2075O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752713.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X5
TrEMBLM0X6C50.0M0X6C5_HORVD; Uncharacterized protein
STRINGMLOC_5739.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-142myb domain protein 4r1