PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_57215.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 410aa    MW: 44299.6 Da    PI: 9.5296
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_57215.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1591.9e-49371622128
           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                   +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++
  MLOC_57215.1  37 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAESSR 132
                   79***************************.89***************8778899******************************************* PP

           NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                    +glkktLvfy+g+apkg++++W+m+eyrl
  MLOC_57215.1 133 PIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 162
                   ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-5536182IPR003441NAC domain
PROSITE profilePS5100555.15636183IPR003441NAC domain
PfamPF023651.5E-2438162IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MSSRYEGGAA AVAAAGAGAG GVKEGGGRDA HEDDLVMPGF RFHPTEEELI EFYLRRKVEG  60
KRFNVELITF LDLYRYDPWE LPALAAIGEK EWFFYVPRDR KYRNGDRPNR VTASGYWKAT  120
GADRMIRAES SRPIGLKKTL VFYSGKAPKG VRSSWIMNEY RLPTADTDRY HKTEISLCRV  180
YKRTGIDDGR GHPSSARSTM PSRRGAEARQ DNRQGSSSTS TPTPPPTPSK LHLLQAGECT  240
SPPAPITTDH AQAHRPAAAP RQQVAETVKP SGGSLGFLQS AAAADRHQQE GAAALLYQQY  300
SKSTNTFAST YSLLNLVNAA SMGVASAAAI DELSTLVGHG AAQLPSYHSP ASTGGHHNHF  360
VVPLPTPPSQ PITPLGTLPM SLAAISDKIW DWNPIPDAVA GRDYGGAGFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-543818319165NO APICAL MERISTEM PROTEIN
1ut4_B9e-543818319165NO APICAL MERISTEM PROTEIN
1ut7_A9e-543818319165NO APICAL MERISTEM PROTEIN
1ut7_B9e-543818319165NO APICAL MERISTEM PROTEIN
4dul_A9e-543818319165NAC domain-containing protein 19
4dul_B9e-543818319165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_57215.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197620.0FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020179754.10.0protein BEARSKIN2-like
TrEMBLM0X5K00.0M0X5K0_HORVV; Uncharacterized protein
STRINGMLOC_57215.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-103NAC domain containing protein 35