PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_56075.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 165aa    MW: 17985.6 Da    PI: 8.7626
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_56075.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.18.1e-40561551100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrr+Ca++C+++p f   +p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq++ l+aela++
  MLOC_56075.1  56 PCAACKLLRRRCAQECPFSPFFSPLEPHKFASVHKVFGASNVSKMLLEVHESQRGDAANSLVYEANLRLRDPVYGCMGAILTLQQQVHALEAELAAV 152
                   7***********************************************************************************************9 PP

        DUF260  98 kee 100
                   ++e
  MLOC_56075.1 153 RAE 155
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.11455156IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-4056153IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MSTASDWQQD HEVGKKIKSE STAEADRMMA AARRSSSLPA AGAGPASTPS FNTMTPCAAC  60
KLLRRRCAQE CPFSPFFSPL EPHKFASVHK VFGASNVSKM LLEVHESQRG DAANSLVYEA  120
NLRLRDPVYG CMGAILTLQQ QVHALEAELA AVRAEILKHR YRPAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-415615911114LOB family transfactor Ramosa2.1
5ly0_B7e-415615911114LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_56075.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0958311e-117FP095831.1 Phyllostachys edulis cDNA clone: bphyst036h20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167556.11e-117LOB domain-containing protein 15-like
SwissprotQ9AT612e-67LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A287EY421e-119A0A287EY42_HORVV; Uncharacterized protein
STRINGMLOC_56075.11e-120(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-56LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]