PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_55964.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family bHLH
Protein Properties Length: 137aa    MW: 15368.7 Da    PI: 10.0432
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_55964.9genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH19.22.3e-06651041554
                   HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
           HLH  15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                   +i +  ++L++llP+a   ++ ++  + +L++++ YI+sL
  MLOC_55964.9  65 QISDLVSKLQDLLPEARLRGNDRVPSSRVLQETCTYIRSL 104
                   789999*********8899*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.102.9E-749123IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS508889.50250104IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474597.98E-864125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MRMTEVGEPK CFILASKSSL PPALHLLLFK ASSHLQRRCT SSMRLTQAPR SRSRQSGSSR  60
ITDEQISDLV SKLQDLLPEA RLRGNDRVPS SRVLQETCTY IRSLHREVDD LSERLSELLA  120
TSDMSSAQAA IIRSLLM
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_55964.9
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0695692e-94AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020177249.15e-54transcription factor ILI6
SwissprotB8APB54e-45ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR24e-45ILI6_ORYSJ; Transcription factor ILI6
TrEMBLA0A287PPH84e-80A0A287PPH8_HORVV; Uncharacterized protein
STRINGTraes_4DL_ECE64510D.13e-58(Triticum aestivum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.12e-33bHLH family protein