PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_55964.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family bHLH
Protein Properties Length: 92aa    MW: 10377.7 Da    PI: 8.5297
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_55964.8genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH20.49.6e-0720591554
                  HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
           HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                  +i +  ++L++llP+a   ++ ++  + +L++++ YI+sL
  MLOC_55964.8 20 QISDLVSKLQDLLPEARLRGNDRVPSSRVLQETCTYIRSL 59
                  789999*********8899*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.107.7E-8478IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS508889.502559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.49E-81981IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSSRRSRSRQ SGSSRITDEQ ISDLVSKLQD LLPEARLRGN DRVPSSRVLQ ETCTYIRSLH  60
REVDDLSERL SELLATSDMS SAQAAIIRSL LM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0695692e-97AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752676.11e-45PREDICTED: transcription factor ILI6 isoform X3
RefseqXP_014752675.11e-45PREDICTED: transcription factor ILI6 isoform X3
RefseqXP_014752670.11e-45PREDICTED: transcription factor ILI6 isoform X3
SwissprotB8APB57e-47ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR27e-47ILI6_ORYSJ; Transcription factor ILI6
TrEMBLM0X0203e-57M0X020_HORVD; Uncharacterized protein
STRINGBRADI1G73160.13e-45(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.18e-34bHLH family protein