PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_5585.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family G2-like
Protein Properties Length: 451aa    MW: 49479.7 Da    PI: 6.2799
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_5585.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-33231285155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r+rWtpeLHe+Fv+ v++LGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  MLOC_5585.1 231 KQRMRWTPELHECFVDSVNKLGGSEKATPKGVLKLMKVDGLTIYHVKSHLQKYRT 285
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.796228288IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-31229287IPR009057Homeodomain-like
SuperFamilySSF466893.94E-17230285IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-25231285IPR006447Myb domain, plants
PfamPF002491.2E-8233284IPR001005SANT/Myb domain
PfamPF143792.2E-24314360IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MRRCDLRQCH NSRVSGGMSS SLPILPNSLK ETFHGPYNPQ LTPMQRQLTS DFVPLYQSAF  60
PSATLHPRAG AMRSSYSASL GYSANPLDSV PNHERQSMVA PFAPQSSDIE VFQALSNNIP  120
GGHTEATWFP GSADSLSDYR DNIPASGSQI QNSGPAVTSD VVAKQNEWWA DIMNDDWRDI  180
LDATAADPQS KSMVQPSNSA ASQPAVNQPA SSHGGEICNV ASPPNGNSAA KQRMRWTPEL  240
HECFVDSVNK LGGSEKATPK GVLKLMKVDG LTIYHVKSHL QKYRTARYKP DVTEGTADKR  300
TTTEELTLDL KSSMDLTEAL RLQMEVQKRL HEQLETQRKL QLRIEEQGKY LQMMFEKQSK  360
SNTEKGQDLS SGATTTLSSD PSHSANRNRD NDAADDLHRT GENPVSAEIG ETSMHAGGNR  420
EMAEIESSDP LANTNDGSKA PQEKCRRVHD S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-29230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-29230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-29230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-29230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-29230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-29230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-29230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-29230289160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_5585.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3583140.0AK358314.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1073J04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020173454.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X2
RefseqXP_020173455.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X2
RefseqXP_020173456.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X2
RefseqXP_020173457.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X2
SwissprotB8ANX91e-180PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLM0WZJ10.0M0WZJ1_HORVV; Uncharacterized protein
STRINGMLOC_5585.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-70phosphate starvation response 1