PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_5548.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family GRAS
Protein Properties Length: 405aa    MW: 44159 Da    PI: 4.9611
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_5548.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS79.36.7e-253004032108
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++lLl+cA+a+s+++ + a++lL+r++++++p+gd+ qRla+yf eAL arla+ +sely++l +++ts   +++ l+a +l+  ++ + k++++ aN
  MLOC_5548.1 300 QTLLLNCAQALSTDNRRTASELLKRIRQHSTPKGDAAQRLAHYFGEALDARLAGRGSELYQSLMARRTS---VADFLKANQLYMAACCCKKVAFIFAN 394
                  689**************************************************************9999...************************** PP

         GRAS 100 qaIleaveg 108
                  ++I +av g
  MLOC_5548.1 395 KTICNAVVG 403
                  ****99866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098517.943273405IPR005202Transcription factor GRAS
PfamPF035142.3E-22300403IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MAATPEEFLG QQSFLARLEP PSPSLFLGLP PTPRGVDDRD SSFDDMALPY ISRLLEEDME  60
DHFFYLYPNH PALLRAQLPF AQILVDVADS ASGSTSALSP SSSTSTSTSD ATTPSTTSPY  120
DAAIQISRLP YTQVLGLASG SPDTQSSALL SGDEEAQNPS SDFVIGNYLL PGDQDMLNLS  180
FLKGMEEARK FLPPNSSLPV PAMKVDQAVD GALAGAGLKK KRDTLEPDMG RASKLMTPEQ  240
EEVGAREMFD EMMFQEHEIC MKGVQQLCLR IAVDGEPGKN RRKKGRPRQD SSDSEMVDLQ  300
TLLLNCAQAL STDNRRTASE LLKRIRQHST PKGDAAQRLA HYFGEALDAR LAGRGSELYQ  360
SLMARRTSVA DFLKANQLYM AACCCKKVAF IFANKTICNA VVGRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3664420.0AK366442.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2043B18.
GenBankAK3633460.0AK363346.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2014K12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.11e-136PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.11e-136PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLM0WXR00.0M0WXR0_HORVD; Uncharacterized protein
STRINGMLOC_5548.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.13e-39GRAS family protein