PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_54949.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 156aa    MW: 16751.1 Da    PI: 6.226
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_54949.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.27e-4461051100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +Ca+Ck+lrr+C+kdC++ap fpa++p+kfa+vhk+FGasnv+k+l +lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la++
  MLOC_54949.1   6 PCASCKLLRRRCTKDCIFAPFFPADDPHKFAIVHKVFGASNVSKMLLELPVQQRGDAVSSLVYEANARVRDPVYGCVGAISFLQNQVSQLQMQLAVA 102
                   7***********************************************************************************************9 PP

        DUF260  98 kee 100
                   ++e
  MLOC_54949.1 103 QAE 105
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.0965106IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MAGGSPCASC KLLRRRCTKD CIFAPFFPAD DPHKFAIVHK VFGASNVSKM LLELPVQQRG  60
DAVSSLVYEA NARVRDPVYG CVGAISFLQN QVSQLQMQLA VAQAEILCIQ MQQRDGCQSQ  120
DDAGRNDGHS LAAMQQMVVD DTAAAEAFLM QNGGGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4731078112LOB family transfactor Ramosa2.1
5ly0_B1e-4731078112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_54949.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020146571.11e-110LOB domain-containing protein 12
SwissprotQ8LBW38e-71LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A287FUJ41e-110A0A287FUJ4_HORVV; Uncharacterized protein
STRINGMLOC_54949.11e-111(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-73LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]