PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_52982.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 82aa    MW: 9634.82 Da    PI: 11.6627
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_52982.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.6e-151559347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +W++eE++l++d+  ++G g+W+ I+r     Rt+ q+ s+ qky
     MLOC_52982.2 15 PWSEEEHKLFLDGLDKYGRGDWRNISRFAVRSRTPTQVASHAQKY 59
                     7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.082764IPR017930Myb domain
SuperFamilySSF466891.0E-171064IPR009057Homeodomain-like
SMARTSM007176.8E-101262IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.9E-171363IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-111559IPR009057Homeodomain-like
CDDcd001672.78E-101560No hitNo description
PfamPF002493.8E-121559IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
RAGKPRREER RRGIPWSEEE HKLFLDGLDK YGRGDWRNIS RFAVRSRTPT QVASHAQKYF  60
IRQASAATRD SKRKSIHDIT TP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3673731e-134AK367373.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2055O05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567296.12e-49PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-35DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLF2DU054e-53F2DU05_HORVD; Predicted protein
TrEMBLM0WMN52e-54M0WMN5_HORVD; Uncharacterized protein
STRINGMLOC_52982.25e-54(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.15e-33Homeodomain-like transcriptional regulator