PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_5148.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 177aa    MW: 19674.4 Da    PI: 7.3707
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_5148.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.51.1e-43121111100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+Ca+dCv+apyfp e+p++fa vh++FGasnv+k+l++lp  +r da+sslvyeA ar+rdPvyG++g i+ lqqq++ql+++la+++
  MLOC_5148.1  12 PCASCKLLRRRCARDCVFAPYFPPEDPHRFATVHRVFGASNVSKMLQELPAAQRADAVSSLVYEATARMRDPVYGCAGAISYLQQQVSQLQVQLAVAQ 109
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  MLOC_5148.1 110 AE 111
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.56811112IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MAGAQTGSSA TPCASCKLLR RRCARDCVFA PYFPPEDPHR FATVHRVFGA SNVSKMLQEL  60
PAAQRADAVS SLVYEATARM RDPVYGCAGA ISYLQQQVSQ LQVQLAVAQA EIIQRINHPS  120
PSAAFHLQEL QQRQAQQQQQ MQMDDDDKAY SSLVMQNDLM STLLLQEACL KKESLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1008522e-89FP100852.1 Phyllostachys edulis cDNA clone: bphyst013p01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238823.12e-83PREDICTED: LOB domain-containing protein 4-like
SwissprotQ8LBW37e-65LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM0WH931e-129M0WH93_HORVD; Uncharacterized protein
STRINGMLOC_5148.11e-128(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-53LBD family protein