PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_5148.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 177aa    MW: 19674.4 Da    PI: 7.3707
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_5148.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.51.1e-43121111100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+Ca+dCv+apyfp e+p++fa vh++FGasnv+k+l++lp  +r da+sslvyeA ar+rdPvyG++g i+ lqqq++ql+++la+++
  MLOC_5148.1  12 PCASCKLLRRRCARDCVFAPYFPPEDPHRFATVHRVFGASNVSKMLQELPAAQRADAVSSLVYEATARMRDPVYGCAGAISYLQQQVSQLQVQLAVAQ 109
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  MLOC_5148.1 110 AE 111
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.56811112IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MAGAQTGSSA TPCASCKLLR RRCARDCVFA PYFPPEDPHR FATVHRVFGA SNVSKMLQEL  60
PAAQRADAVS SLVYEATARM RDPVYGCAGA ISYLQQQVSQ LQVQLAVAQA EIIQRINHPS  120
PSAAFHLQEL QQRQAQQQQQ MQMDDDDKAY SSLVMQNDLM STLLLQEACL KKESLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-4821141113LOB family transfactor Ramosa2.1
5ly0_B7e-4821141113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_5148.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1008522e-89FP100852.1 Phyllostachys edulis cDNA clone: bphyst013p01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020183946.11e-101LOB domain-containing protein 12-like
SwissprotQ8LBW31e-63LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM0WH931e-127M0WH93_HORVV; Uncharacterized protein
STRINGMLOC_5148.11e-128(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-53LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]