PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_51353.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family CPP
Protein Properties Length: 770aa    MW: 83368.3 Da    PI: 7.1155
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_51353.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.6e-16459497240
           TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                   ++k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  MLOC_51353.2 459 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 497
                   689**********************************96 PP

2TCR49.39.9e-16544583140
           TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                   ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce CkN+ 
  MLOC_51353.2 544 RHKRGCNCKKSSCLKKYCECYQGGVGCSNNCRCETCKNTF 583
                   589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.7E-17458499IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.996459584IPR005172CRC domain
PfamPF036388.7E-12461496IPR005172CRC domain
SMARTSM011141.6E-15544585IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.3E-11546582IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MQDSPLFSFI DSLSPIEPLK SAYSGNGLQA YHQSLNITSV SSIFTSPHDN AHKESKKTKS  60
SFADYTENEL CMEDGTDKNK SSTSSTAVKL FACTSTITRE SHTMITCSVN ESIVDPPNGP  120
NDLPQPGRFD SGSPDHNTAP CHGVSVRSDL KQDKCPKLEA VQTTNNTMEK RKCLFSTDMQ  180
LQDGCQTSKE NQVMGCEWDD LVSVTSGELL AFDSSMDQHH TGVQLAVNNA ESCGYLLSKL  240
AGGAADISDS RTHPTTSNKA YYHEMVVGED KTENGQFFPE DKKTILSEEI QDNINEDNGC  300
IPLGCKVETQ QRGVRRRCLV FEAAGYSHRT VQKESVGDLS FSTCKGKSPA QNHRNPGKTP  360
PHVFRGIGLH LNALALTSKD KMACQDPLAS ALVPSLKTEQ AVHGSAGVNS VHSGGGLLDL  420
QMDNDDCSIG GFLGNDHNSS QSSSPPKKRR KSDNGDDESC KRCSCKKSKC LKLYCECFAA  480
GVYCSEPCSC QGCLNKPIHE EIVLSTRKHI EFRNPLAFAP KVIRMSEAGQ EAQEDPKNTP  540
ASARHKRGCN CKKSSCLKKY CECYQGGVGC SNNCRCETCK NTFGTRDVAV SAENEEMKQE  600
DDQTESCGKE KENDQQKANV HSEDHKLVEL VVPITPPWDV SSSLLKQPNF SIAKPPRPRK  660
ARSGSSSRSS KASETVQSCK IPKAGDSVFI EEMPDILREP SSPGIVKTCS PNGKRVSPPH  720
NALSISPNRK GGRKLILKSI PSFPSLIGDT NGGSAICSSD SATPLALGPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1546158112120Protein lin-54 homolog
5fd3_B1e-1546158112120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1445451PKKRRKS
2446450KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_51353.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3750970.0AK375097.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3085F14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167196.10.0protein tesmin/TSO1-like CXC 3
TrEMBLM0WGX30.0M0WGX3_HORVV; Uncharacterized protein
STRINGMLOC_51353.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.19e-67TESMIN/TSO1-like CXC 2