PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_49381.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family TCP
Protein Properties Length: 109aa    MW: 11812.5 Da    PI: 11.955
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_49381.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP119.54e-37993691
           TCP  6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaa 91
                   r+ ++hTkv+gR+RR+R++a caar+F+L++eLG+++d++t+ WLlqq++pai ++tgt++ +a ++ +++ +    ++ss++a+
  MLOC_49381.1  9 PRNRDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETVRWLLQQSEPAIVAATGTGTVPAIAT-TVDGVLRIPTQSSSSAS 93
                  6999********************************************************77777333.33333333322222221 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.9E-311191IPR005333Transcription factor, TCP
PROSITE profilePS5136926.9321165IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0048364Biological Processroot development
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MAVVRKPPPR NRDRHTKVEG RGRRIRMPAA CAARIFQLTR ELGHKSDGET VRWLLQQSEP  60
AIVAATGTGT VPAIATTVDG VLRIPTQSSS SASSAVVDDD ASAKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00638PBMTransfer from Lj0g3v0004489Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_49381.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020148818.18e-65transcription factor PCF2-like
SwissprotA2YXQ11e-59PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH61e-59PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A287SWJ09e-69A0A287SWJ0_HORVV; Uncharacterized protein
STRINGMLOC_49381.12e-72(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.22e-43TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]