PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_45078.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family ZF-HD
Protein Properties Length: 96aa    MW: 10520.7 Da    PI: 7.286
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_45078.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer91.76.6e-291876160
   ZF-HD_dimer  1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                  +++vrY eC++NhAas+Gg+avDGC+Ef+++ geegt  alkC+ACgCHR+FH r +++e
  MLOC_45078.1 18 CCGVRYGECRRNHAASTGGYAVDGCREFIAE-GEEGTFGALKCSACGCHRSFHHRVQVYE 76
                  5789**************************8.999********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-26180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.0E-282173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.9E-222271IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.4132372IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MKRLVVLRRC EPIVRFSCCG VRYGECRRNH AASTGGYAVD GCREFIAEGE EGTFGALKCS  60
ACGCHRSFHH RVQVYEVAWD CESDTSSSSS SSSSSD
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_45078.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3757151e-157AK375715.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3102E24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020146636.15e-62mini zinc finger protein 3-like
SwissprotQ6ER224e-34MIF3_ORYSJ; Mini zinc finger protein 2
TrEMBLA0A446T4331e-60A0A446T433_TRITD; Uncharacterized protein
TrEMBLA0A453KXK41e-60A0A453KXK4_AEGTS; Uncharacterized protein
TrEMBLW5FWN31e-60W5FWN3_WHEAT; Uncharacterized protein
STRINGMLOC_45078.42e-63(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-26mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]