PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_43730.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family GRAS
Protein Properties Length: 597aa    MW: 67201.4 Da    PI: 6.2874
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_43730.10genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS322.39.6e-992195882373
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lL++cA+ v + d + a +lL++++++asp+gd++qRla  f+e+L+arl++++s++y  l+++ ts    ++++ a++lf  ++ + k+++l 
  MLOC_43730.10 219 HTLLIHCAKSVMD-DRRSAGELLKEIKQHASPTGDATQRLAYWFAEGLEARLTGTGSQVYGLLTAECTS---RVRHMEAYQLFMSTCCFRKVAFLF 310
                    679******9987.8999******************************************999998888...8999******************** PP

           GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                    aN+aI +a+ g +r+Hi+D+++  G+QWp Ll+ LasR++gpp++RiT ++ p++g   ++ +e++g+rLa++A+elgvpf++++ ++ +++++ +
  MLOC_43730.10 311 ANKAIFNAAVGRSRLHIVDYGLHCGFQWPELLRWLASRDGGPPEVRITHIELPQPGvyLEKHMEQIGNRLADIAQELGVPFKYRA-IMAQWQTICV 405
                    ********************************************************9999*************************.6999****** PP

           GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                    e+L+++p+EalaVn +++  +l+desv +++  +rd+vL  + +++P+v+v +  + ++ ++ Fl rf eal y+sa+fd+l+a++pres+ r  +
  MLOC_43730.10 406 EDLNMEPDEALAVNDQFNFRTLMDESVVIANlnPRDAVLGNISKMKPDVFVQSTVNGSY-GTFFLSRFREALFYHSAVFDMLDATMPRESKLRLAL 500
                    ****************************999999***********************99.789********************************* PP

           GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                    Er ++g+ + n+va eg++r+er et+++W+ r ++aG++++pl+ +++k a+ ++   + + + ++e++++l++gWk+r L++ S W
  MLOC_43730.10 501 ERDVFGWIVLNAVAYEGEDRVERGETYKHWQIRNQRAGLRQLPLNRETVKMARDMVMGDYHKDFDIDEDHQWLLQGWKGRILYAHSTW 588
                    *****************************************************9998888788************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.369192569IPR005202Transcription factor GRAS
PfamPF035143.3E-96219588IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MASTPVFPVF PDLPLMAHDD NHRFAVQDHL ALPYIAQILM EEEDDVDEDN PALLKAQWPF  60
AQILSSSMHA STLMADQGGA LAIDVHSPNS AIDVNSPSSA IFKFKGVDEV RSLLLLPNGD  120
YNTHMFSTAF VRGMEEANKF LPTNCELTTT GGHDLPKEKS GRGRKGRHGE VDADISRTSR  180
LVEAGAGEVL DQMLIAMSNE TGNRNKKGRK SKARVVDLHT LLIHCAKSVM DDRRSAGELL  240
KEIKQHASPT GDATQRLAYW FAEGLEARLT GTGSQVYGLL TAECTSRVRH MEAYQLFMST  300
CCFRKVAFLF ANKAIFNAAV GRSRLHIVDY GLHCGFQWPE LLRWLASRDG GPPEVRITHI  360
ELPQPGVYLE KHMEQIGNRL ADIAQELGVP FKYRAIMAQW QTICVEDLNM EPDEALAVND  420
QFNFRTLMDE SVVIANLNPR DAVLGNISKM KPDVFVQSTV NGSYGTFFLS RFREALFYHS  480
AVFDMLDATM PRESKLRLAL ERDVFGWIVL NAVAYEGEDR VERGETYKHW QIRNQRAGLR  540
QLPLNRETVK MARDMVMGDY HKDFDIDEDH QWLLQGWKGR ILYAHSTWVA EGASSHC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-422225888374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758581.10.0PREDICTED: scarecrow-like protein 14
TrEMBLM0W4V80.0M0W4V8_HORVD; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-128GRAS family protein