PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_38289.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family CO-like
Protein Properties Length: 364aa    MW: 37932.5 Da    PI: 6.1058
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_38289.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.98.7e-0860105342
      zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                    ++C+ +e  ++   C+ +   lC+ C   +H+       H++vp+
  MLOC_38289.3  60 VWVCEVCELAPAAVTCKADAAALCAACDADIHHAnplarrHERVPV 105
                   689****************************645599999999986 PP

2CCT71.12.7e-24289332144
           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                   Rea+l+RY+eKrk+R+FeK+irY+sRKa+AesRpRvKGrF+k+a
  MLOC_38289.3 289 REARLMRYREKRKNRRFEKTIRYASRKAYAESRPRVKGRFAKRA 332
                   9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0741262IPR000315B-box-type zinc finger
PROSITE profilePS5011911.23458105IPR000315B-box-type zinc finger
PfamPF006431.1E-559105IPR000315B-box-type zinc finger
SMARTSM003369.4E-863105IPR000315B-box-type zinc finger
PfamPF062035.6E-18289331IPR010402CCT domain
PROSITE profilePS5101716.986289331IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MELQGLGRYW GVGGRRCGAC AGSPAAVHCR TCDGRRGGGD GAYLCAGCDA GHARAGHERV  60
WVCEVCELAP AAVTCKADAA ALCAACDADI HHANPLARRH ERVPVLPIGS SSPEGQEQDA  120
FVMSFGGSVD GEKQDAVVNL NDALEAGPDG KENVKLDFLF ADMMDPFFGS ELPRFPHADS  180
VVPSGGAVEL DFGGVAAAAA VVSNPSYSSY TAASIGGSGS SSEVGLVPDA ICGRGGGIIE  240
LDFAQSKAAY LPYTPTPSHS TVSSVDVGPV PERSESAVAA ATPAMGEGRE ARLMRYREKR  300
KNRRFEKTIR YASRKAYAES RPRVKGRFAK RADDADADAV AAATITAPRP CVLDFSGYGV  360
VPTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3672190.0AK367219.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2053C02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570553.11e-139PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLF2DTK10.0F2DTK1_HORVD; Predicted protein
STRINGMLOC_38289.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-31CONSTANS-like 3