PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_35578.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family TCP
Protein Properties Length: 74aa    MW: 8266.46 Da    PI: 11.0134
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_35578.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP98.61.1e-302272353
           TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlq 53
                  ++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t+eWLl+
  MLOC_35578.1 22 VAKRPTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKTDGETVEWLLE 72
                  689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.5E-252773IPR005333Transcription factor, TCP
PROSITE profilePS5136924.2062774IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
GGRPPNHSQS ITVAEPPSEK KVAKRPTKDR HTKVDGRGRR IRMPALCAAR VFQLTRELGH  60
KTDGETVEWL LEPA
Functional Description ? help Back to Top
Source Description
UniProtCan specifically bind site II elements in the promoter region of PP438/PNM1. {ECO:0000269|PubMed:21297037}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_35578.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3610021e-112AK361002.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1130G02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194047.13e-40transcription factor PCF3-like
SwissprotQ9C5181e-26TCP8_ARATH; Transcription factor TCP8
TrEMBLF2DAT87e-42F2DAT8_HORVV; Predicted protein
STRINGMLOC_35578.11e-47(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.15e-29TCP family protein
Publications ? help Back to Top
  1. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]