PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_24269.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family TCP
Protein Properties Length: 147aa    MW: 15225.1 Da    PI: 7.0306
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_24269.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP83.93.9e-261732496
           TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaak 96
                  +++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tg+++++as+++++ ss   +++ ++ aa+ +++
  MLOC_24269.1  1 MPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGSGTTPASFSTSSPSSLRPHAHAQPLAASPHHP 73
                  9*****************************************9999988844434443333333333333322 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136920.861139IPR017887Transcription factor TCP subgroup
PfamPF036342.8E-20164IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MPIICAARVF QLTRELGHKS DGQTIEWLLR QAEPSIIAAT GSGTTPASFS TSSPSSLRPH  60
AHAQPLAASP HHPHHHLPHA APFILGKRVR DDDDNGSGNG APSGEATVAA ASMGPAPGFW  120
ALPARGDFGQ MWSFAPPPEM MGAAPGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_24269.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3748350.0AK374835.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3077J21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020185649.12e-69transcription factor TCP21-like
SwissprotQ9FMX27e-49TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A287V9302e-98A0A287V930_HORVV; Uncharacterized protein
TrEMBLA0A287V9671e-98A0A287V967_HORVV; Uncharacterized protein
STRINGMLOC_24269.11e-101(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP194133100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.14e-32TCP family protein