PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_22988.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family Trihelix
Protein Properties Length: 387aa    MW: 42519 Da    PI: 9.313
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_22988.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix111.16.8e-35295380187
      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                   rW+k ev+aLi++r +m++r++++  k+plWee+s+ mr+ g++r++k+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+qlea
  MLOC_22988.3 295 RWPKTEVHALIQLRMDMDNRYQENGPKGPLWEEISAGMRRLGYSRNSKRCKEKWENINKYFKKVKESNKRR-PEDSKTCPYFHQLEA 380
                   8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.073288352IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.1E-4293351IPR009057Homeodomain-like
PfamPF138371.4E-22294381No hitNo description
CDDcd122031.37E-28295359No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MHAFSSPQPM SAMPPPPGPI QPAPISSAAP APAVEPPQPP PVSLQGLSFP SMSDSESDDD  60
DASEDDDMTA ETGGSPDGVG KRKRGGSKKM MAFFEGLMKQ VIQRQEEMQQ RFLETMEKRE  120
AERTAREEAW RRQEVARLNR EQEQLAQERA AAASRDASII AFLQRIGGQT VHVPPVVIPM  180
PTPMQAQTPP PAKKPRQQLP PPPPSQATHH PQPKPIPAAP LQQQPPALQQ QPPPQPPQHK  240
ETTHDEAGTP RSAPAPTSAG LSLALVPVAT EQHVGEAAGL GLGGGESGGG ASSSRWPKTE  300
VHALIQLRMD MDNRYQENGP KGPLWEEISA GMRRLGYSRN SKRCKEKWEN INKYFKKVKE  360
SNKRRPEDSK TCPYFHQLEA IYRKKHN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3589110.0AK358911.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1085J16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240190.11e-130PREDICTED: trihelix transcription factor GTL1-like isoform X1
RefseqXP_010240191.11e-131PREDICTED: trihelix transcription factor GTL1-like isoform X2
TrEMBLM0VD090.0M0VD09_HORVD; Uncharacterized protein
TrEMBLM0VD100.0M0VD10_HORVD; Uncharacterized protein
STRINGMLOC_22988.10.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.19e-51Trihelix family protein