PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_21297.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family GRAS
Protein Properties Length: 648aa    MW: 72033.7 Da    PI: 6.4551
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_21297.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS347.52.2e-1062706421374
          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                   l++lL++cA+av+++d + a++lL++++ +a pdgd +qRla++f+e+L+ar+a+++  + ++l +++ s    ++ l+a++l+  +  + k+ +l 
  MLOC_21297.1 270 LRTLLIHCAQAVATDDRRSATELLKQIKLHARPDGDGTQRLAHCFAEGLQARMAGTGGLVHQSLMATRIS---AVDMLKAYQLYMAAICFKKVFFLF 363
                   6789***************************************************888888777777776...9*********************** PP

          GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                    N++I++a  g++++HiiD++i++G+QWp++l+ +++Rp+gpp++RiTg++ p++g   +e++eetg+rL+k+A+e++vpf+++v++  +le+l+ e
  MLOC_21297.1 364 SNSTIYNASLGKKKIHIIDYGIQYGFQWPCFLRRISQRPGGPPNVRITGIDLPQPGfrPTERIEETGRRLKKYAHEFNVPFQYRVIARAKLESLRKE 460
                   *******************************************************9*****************************9889******** PP

          GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                   +L+++p+E+l+Vn+ lq ++l+desv les+rd vLk +++++P+ ++++  + + +++ F++rf e l +ysalfd l+++ pr++e+r+ +E+ +
  MLOC_21297.1 461 DLDIDPDEVLIVNSLLQFKNLMDESVVLESPRDVVLKNIRKMRPHTFIHAIVNGSFSAPFFVTRFREVLFFYSALFDVLDTTTPRDNEQRMLIEQNI 557
                   ************************************************************************************************* PP

          GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   lgr++ nv+aceg++r+er et+++W+ r ++aG+k +pl+ ++   a+  +++++ + + ++ ++++l++gWk+r L+++S W+
  MLOC_21297.1 558 LGRAALNVIACEGTDRVERPETYKQWQVRNQRAGLKLLPLNPEVIGLARDKVKNCYHKDFVIDVDQQWLLQGWKGRILYAISTWT 642
                   ********************************************************889*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.252244622IPR005202Transcription factor GRAS
PfamPF035147.5E-104270642IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MEEDIDDKFF YDFPDNPALL EAQQPFLEIL SDPSSNSTSD DSNNRAVSPC SPSDASVGTA  60
AQLPPTPAAV DSYDRFRYEP VDLDPAAFFG GGASSDLMSS AFLKGMQEAN KFLPSQDKLV  120
IDLEASSGQF FKGVEEGNKF LPREDKLVAG FNGHAAPASA PAVLSVKKEE AVDSVSANSG  180
GGRGRKNPYH DDELEQEGGR SSKQSALGDD VSAREMFDRM LMPSDEMCIV QMENLRIAMQ  240
EAVAKNDGGG GKGGNGKGRG RRGGSDVVDL RTLLIHCAQA VATDDRRSAT ELLKQIKLHA  300
RPDGDGTQRL AHCFAEGLQA RMAGTGGLVH QSLMATRISA VDMLKAYQLY MAAICFKKVF  360
FLFSNSTIYN ASLGKKKIHI IDYGIQYGFQ WPCFLRRISQ RPGGPPNVRI TGIDLPQPGF  420
RPTERIEETG RRLKKYAHEF NVPFQYRVIA RAKLESLRKE DLDIDPDEVL IVNSLLQFKN  480
LMDESVVLES PRDVVLKNIR KMRPHTFIHA IVNGSFSAPF FVTRFREVLF FYSALFDVLD  540
TTTPRDNEQR MLIEQNILGR AALNVIACEG TDRVERPETY KQWQVRNQRA GLKLLPLNPE  600
VIGLARDKVK NCYHKDFVID VDQQWLLQGW KGRILYAIST WTANDASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-432746418374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3579960.0AK357996.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1066L11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579265.10.0PREDICTED: scarecrow-like protein 34
TrEMBLM0VAL00.0M0VAL0_HORVD; Uncharacterized protein
STRINGMLOC_21297.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-158GRAS family protein