PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_16076.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 292aa    MW: 31057.4 Da    PI: 7.1605
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_16076.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.66.8e-411032021100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++pe er da+sslvyeA+ r+rdPvyG++g i+ lqqq++ l+ael+++
  MLOC_16076.3 103 PCAACKLLRRRCAHECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVPEAERADAASSLVYEANLRLRDPVYGCMGAISMLQQQVNALEAELEAV 199
                   7**********************************************************************************************99 PP

        DUF260  98 kee 100
                   ++e
  MLOC_16076.3 200 RAE 202
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.407102203IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-41103200IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MPCLLSTLSF LAIPNFTLLY HVPVRLSSPR SQLFLCHSPS PKRGEHASMS TERERLDEIG  60
KKIKREPDPA AIAGVVVAVS PTEHHVHRRL GPGIGGAVNI ATPCAACKLL RRRCAHECPF  120
APYFSPHEPH KFAAVHKVFG ASNVSKMLLE VPEAERADAA SSLVYEANLR LRDPVYGCMG  180
AISMLQQQVN ALEAELEAVR AEIFKHRYRQ AGVGVGVGAA NLIVDDGAAA AGGFMPPSTT  240
LVHTADVVSV AEAGQEVATL PATPTATAYA AGQPSSADYS SLNTSEHDAY FG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7955610.0AY795561.1 Triticum aestivum LOB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644931.11e-111PREDICTED: LOB domain-containing protein 15 isoform X1
SwissprotQ8L5T53e-72LBD15_ARATH; LOB domain-containing protein 15
TrEMBLM0UZN00.0M0UZN0_HORVD; Uncharacterized protein
STRINGMLOC_16076.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-66LOB domain-containing protein 15