PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_16076.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 146aa    MW: 15113.8 Da    PI: 4.1413
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_16076.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26054.82.7e-1715645100
        DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                   +l ++pe er da+sslvyeA+ r+rdPvyG++g i+ lqqq++ l+ael+++++e
  MLOC_16076.2   1 MLLEVPEAERADAASSLVYEANLRLRDPVYGCMGAISMLQQQVNALEAELEAVRAE 56 
                   57789**********************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.7E-15154IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089111.931157IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MLLEVPEAER ADAASSLVYE ANLRLRDPVY GCMGAISMLQ QQVNALEAEL EAVRAEIFKH  60
RYRQAGVGVG VGAANLIVDD GAAAAGGFMP PSTTLVHTAD VVSVAEAGQE VATLPATPTA  120
TAYAAGQPSS ADYSSLNTSE HDAYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-1616055114LOB family transfactor Ramosa2.1
5ly0_B3e-1616055114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_16076.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7955611e-156AY795561.1 Triticum aestivum LOB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020158005.12e-80LOB domain-containing protein 15-like
TrEMBLM0UZM81e-100M0UZM8_HORVV; Uncharacterized protein
STRINGMLOC_16076.33e-99(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-20LOB domain-containing protein 15