PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_16037.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 133aa    MW: 14839 Da    PI: 10.6791
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_16037.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92.1e-173178148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEde l++ v++ G g+W+t +r+ g+ R++k+c++rw +yl
     MLOC_16037.2 31 RGPWTAEEDEVLARFVAREGEGRWRTLPRRAGLLRCGKSCRLRWMNYL 78
                     89******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.5222682IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-202780IPR009057Homeodomain-like
SMARTSM007175.2E-123080IPR001005SANT/Myb domain
PfamPF002496.1E-153178IPR001005SANT/Myb domain
SuperFamilySSF466892.47E-2232107IPR009057Homeodomain-like
CDDcd001671.53E-103378No hitNo description
Gene3DG3DSA:1.10.10.608.9E-781105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MARRKPPAQH GGARSEDGQA QTTTAPPPLK RGPWTAEEDE VLARFVAREG EGRWRTLPRR  60
AGLLRCGKSC RLRWMNYLRP DIKRGPIAED EEDLILRLHR VLGNRCVHVT YSLKCVHADG  120
GADGRVAVHA GGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1627113388B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3765621e-172AK376562.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3127N16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567025.12e-55PREDICTED: transcription repressor MYB5-like
SwissprotQ388505e-42MYB5_ARATH; Transcription repressor MYB5
TrEMBLM0UZI85e-93M0UZI8_HORVD; Uncharacterized protein
STRINGMLOC_16037.36e-70(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.13e-43myb domain protein 5