PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_15181.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family GRAS
Protein Properties Length: 509aa    MW: 56405.5 Da    PI: 5.4012
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_15181.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS279.69e-861705082342
          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                    +lL++cA+a + +d ++a +lL +++ +asp+gd +qRla  f+e+L+arla+++s++y ++++++ts    + +  a+++f  ++ + ++s l a
  MLOC_15181.1 170 HTLLIHCARATT-DDRRRAGELLMEIQLHASPAGDGTQRLAYWFAEGLEARLAGTGSQVYGTITAKATS---AVVHSEAYQAFISTCCFRNVSILFA 262
                   679******765.599*************************************************9999...899999******************* PP

          GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                   N+aIl+a++g +r+Hi+D++  +G+QW  Ll++La+R++g+p++RiT ++ p++g    + +ee+g rL+++A+elgvpf++++ +  +++++  e+
  MLOC_15181.1 263 NRAILNAAAGRSRLHIVDYGFCYGFQWSELLRSLAARDGGSPEVRITHIDLPQPGlhPGRHMEEVGGRLTDIARELGVPFKYRA-ILAQWQTVCAED 358
                   ******************************************************99999*************************.6999******** PP

          GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                   L+++++E+laVn  ++  +l+de v + s  +rd vL+ v +++P+v+v +  + ++ ++ Fl rf  al +ysa+fd+l+a++prese r  +Er 
  MLOC_15181.1 359 LDLEEDEVLAVNDLYNFRTLMDECVVVGSpnPRDVVLSNVCRMKPDVFVQSTVNGSY-GTFFLSRFRGALFFYSAMFDMLDATMPRESELRLALERG 454
                   ***********************988877669***********************99.789************************************ PP

          GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr 342
                   ++g+ + n+va eg++r+er et+++W+ r ++aG++++pl+++++k a+ +++
  MLOC_15181.1 455 VFGWVALNAVAYEGEDRVERGETFRHWQVRNQRAGLRQLPLDKETVKMARDMVK 508
                   ***********************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.179143509IPR005202Transcription factor GRAS
PfamPF035143.1E-83170508IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055085Biological Processtransmembrane transport
GO:0005741Cellular Componentmitochondrial outer membrane
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MEEEEDDDVD QDNPALLKAQ RPFAQILSSS THASKGSALA SDVHSPSPAT FKFKGVDEVR  60
SLLLLANGED NTHIFSTAFL KGMEEAKKFL PTNCELTTTG AQDQPKEKSG SGREDRSDEV  120
EADASRTNGS VGARACEVFD FDQMCSSMDN ETGSSSKKGR KSKARVIDLH TLLIHCARAT  180
TDDRRRAGEL LMEIQLHASP AGDGTQRLAY WFAEGLEARL AGTGSQVYGT ITAKATSAVV  240
HSEAYQAFIS TCCFRNVSIL FANRAILNAA AGRSRLHIVD YGFCYGFQWS ELLRSLAARD  300
GGSPEVRITH IDLPQPGLHP GRHMEEVGGR LTDIARELGV PFKYRAILAQ WQTVCAEDLD  360
LEEDEVLAVN DLYNFRTLMD ECVVVGSPNP RDVVLSNVCR MKPDVFVQST VNGSYGTFFL  420
SRFRGALFFY SAMFDMLDAT MPRESELRLA LERGVFGWVA LNAVAYEGED RVERGETFRH  480
WQVRNQRAGL RQLPLDKETV KMARDMVKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-411735098342GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758581.10.0PREDICTED: scarecrow-like protein 14
TrEMBLM0UWY20.0M0UWY2_HORVD; Uncharacterized protein
STRINGMLOC_15181.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.14e-94SCARECROW-like 14