PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_14828.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family GRAS
Protein Properties Length: 475aa    MW: 51662.2 Da    PI: 6.8805
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_14828.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2813.5e-86784731374
          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                   l+++L +cA+a+++g++el+++ L+ +  las dg+p++Rla+ f+ A+a r+++ ++++++al  ++t++    e++aa++ f  ++P+l+++  +
  MLOC_14828.1  78 LIKVLNACADALDKGEKELVNKGLQMICSLASDDGEPLHRLASLFADAMALRMVQPWQGVCRALGLQKTTP--APETAAARRQFAVMCPFLRIAGTA 172
                   5789************************************************************9988885..8899999***************** PP

          GRAS  98 aNqaIleavege..ervHiiDfdisqGlQWpaLlqaLa.sRp...egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                   aN aI +a++++    +H++D++  ++ QW+ Ll+ +a +Rp   +    lR+T v++    + e l+ t+  La+ A++l+v f+f+++  +  + 
  MLOC_14828.1 173 ANYAIIKATQTKnnAVLHVVDLGGANPDQWLLLLRLFAtTRPragAHDQILRLTIVNE----EDEFLSGTAALLASEAARLHVGFQFHPVKLNINQL 265
                   ********998864566*********************889875444569********....99*************************87777788 PP

          GRAS 189 leleeLrvkpgEalaVnlvlqlhrll.................desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                   l++e L v++gEal++ + lqlhrll                 ++ +++  + d++L+ + +lsPk++vv+eqeadhn+++F  r  +al+yy al+
  MLOC_14828.1 266 LSIEPLGVRTGEALVIVSTLQLHRLLadefaevaanphdrkgkKQVHATMTRADALLRDLAGLSPKLMVVTEQEADHNGAEFTGRYRKALKYYGALL 362
                   8***************************************9975555556679******************************************** PP

          GRAS 269 dsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrve.eesgslvl 360
                   d+l++++p+     er+ vEr ll +ei+++vacega+rrerhe + kW +r+++aGF p+ +s ++++q   l +  +  s  yrv  ee+g+l++
  MLOC_14828.1 363 DALQESVPARGsaVERAGVERCLLLEEIRDIVACEGAQRRERHEPMLKWAARMDAAGFVPAVMSPDIVAQTGILAHILAggSTAYRVSrEEDGCLFI 459
                   ***999887655799***********************************************************9988865667***9788****** PP

          GRAS 361 gWkdrpLvsvSaWr 374
                   + +d p++svS Wr
  MLOC_14828.1 460 YRNDDPMFSVSTWR 473
                   *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.85652450IPR005202Transcription factor GRAS
PfamPF035141.2E-8378473IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MNPENRGQET TGPVYAPVPL RTAWSVDLGN GLNGTFVHSN IDGTATFLLP EVRSAAAPTH  60
PTAPAAAQTQ YEERAIHLIK VLNACADALD KGEKELVNKG LQMICSLASD DGEPLHRLAS  120
LFADAMALRM VQPWQGVCRA LGLQKTTPAP ETAAARRQFA VMCPFLRIAG TAANYAIIKA  180
TQTKNNAVLH VVDLGGANPD QWLLLLRLFA TTRPRAGAHD QILRLTIVNE EDEFLSGTAA  240
LLASEAARLH VGFQFHPVKL NINQLLSIEP LGVRTGEALV IVSTLQLHRL LADEFAEVAA  300
NPHDRKGKKQ VHATMTRADA LLRDLAGLSP KLMVVTEQEA DHNGAEFTGR YRKALKYYGA  360
LLDALQESVP ARGSAVERAG VERCLLLEEI RDIVACEGAQ RRERHEPMLK WAARMDAAGF  420
VPAVMSPDIV AQTGILAHIL AGGSTAYRVS REEDGCLFIY RNDDPMFSVS TWRTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-22784734375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM0UVY40.0M0UVY4_HORVD; Uncharacterized protein
STRINGMLOC_14828.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137161330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.12e-54scarecrow-like 3