PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_14785.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family TCP
Protein Properties Length: 278aa    MW: 30104.5 Da    PI: 7.983
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_14785.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP967.5e-3052121372
           TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                   g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ +++++++ 
  MLOC_14785.1  52 GGKDRHSKVKTVKGLRDRRVRLSVQTAIQLYDLQDRLGLNQPSKVVDWLLNAARHEIDKLPPLQFPPHQV 121
                   78*************************************************************9999932 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.66553111IPR017887Transcription factor TCP subgroup
PfamPF036343.9E-2853126IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0031347Biological Processregulation of defense response
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0009507Cellular Componentchloroplast
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MMSSNNQQQQ SAAAAAEEEQ ELARKHAAAV ATSRQWSSQT ESRIVRVSRV FGGKDRHSKV  60
KTVKGLRDRR VRLSVQTAIQ LYDLQDRLGL NQPSKVVDWL LNAARHEIDK LPPLQFPPHQ  120
VDLMDHMMTS SSMPLMPHVD DKFCHFASTL AGDGVKAGAD ADGGGAHHNM GRFGYHRFMG  180
LNNNSLGLVN SGMPYNFTGE SWNNSSVHQS GGAGSAQVSI AAAAAAHHSA FPSLLSLAPR  240
SHQLVYYSSD ADQFPVDDLG SQSLSLSSAR GFHDQTGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A3e-2058112155Putative transcription factor PCF6
5zkt_B3e-2058112155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_14785.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2497150.0AK249715.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf45f04, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020168249.11e-171uncharacterized protein LOC109753738
TrEMBLM0UVT20.0M0UVT2_HORVV; Uncharacterized protein
STRINGMLOC_14785.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.13e-39TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5