PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_14305.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LFY
Protein Properties Length: 323aa    MW: 34905.6 Da    PI: 9.079
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_14305.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY3964.6e-12113231330
       FLO_LFY   1 mdpea..fsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslse 95 
                   mdp++  ++a+ f+wd  +   ++pa + +    +++p    a   a++ rele+l+ +yGvr +tva+i+elGft+ tL+ m+++eldd++++l+ 
  MLOC_14305.1   1 MDPNDvfLAAHPFRWDLGS---PAPAAVPPPPPPPPPP---PALPPANAPRELEDLVVGYGVRASTVARISELGFTATTLLVMTERELDDMTAALAG 91 
                   788776447779****532...2333333333222233...345566779*********************************************** PP

       FLO_LFY  96 ifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkk 192
                   +fr+dll+Ger+G++aa+raer rl++      r++  ++  +t+  a+sqe+ls+e++      a+sgg g+ +a  ++a+ kk+++ +  +++kk
  MLOC_14305.1  92 LFRWDLLIGERFGLRAALRAERGRLMSPG---CRHHGYQSG-STVDGAASQEVLSNERD-----GAASGGIGEDDAMRMMASGKKQKNGSAGRKAKK 179
                   **************************955...555533333.3455689*******977.....456666655554444444433333333333445 PP

       FLO_LFY 193 qkrkkkkelkse....ededeee....eededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkv 281
                   ++rkk ++l+      e  +e+     +e+++++ +g  g erqrehPf+vtepgevar+kknGLDYLf+Lye+Cr  Llqvq++ak +G+k+Ptkv
  MLOC_14305.1 180 ARRKKVNDLRLGmqgdE--HEDGggglSESTESSAGGGVGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEECRVLLLQVQSMAKLHGQKAPTKV 274
                   66666665554433321..2222112144555556778889******************************************************** PP

       FLO_LFY 282 tnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkerg 330
                   tnqvfrya k+gasyinkPkmrhYvhCYalhcLde+as+alrra+k+rg
  MLOC_14305.1 275 TNQVFRYASKVGASYINKPKMRHYVHCYALHCLDEDASDALRRAYKARG 323
                   ***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.5E-1421323IPR002910Floricaula/leafy protein
SuperFamilySSF1014473.66E-62636No hitNo description
SuperFamilySSF1014473.66E-6265274No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MDPNDVFLAA HPFRWDLGSP APAAVPPPPP PPPPPPALPP ANAPRELEDL VVGYGVRAST  60
VARISELGFT ATTLLVMTER ELDDMTAALA GLFRWDLLIG ERFGLRAALR AERGRLMSPG  120
CRHHGYQSGS TVDGAASQEV LSNERDGAAS GGIGEDDAMR MMASGKKQKN GSAGRKAKKA  180
RRKKVNDLRL GMQGDEHEDG GGGLSESTES SAGGGVGGER QREHPFVVTE PGEVARAKKN  240
GLDYLFHLYE ECRVLLLQVQ SMAKLHGQKA PTKVTNQVFR YASKVGASYI NKPKMRHYVH  300
CYALHCLDED ASDALRRAYK ARG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A6e-612163231108PROTEIN LEAFY
2vy2_A6e-612163231108PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_14305.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2318880.0AB231888.1 Triticum aestivum WFLa mRNA for FLORICAULA/LEAFY-like protein, complete cds.
GenBankAB2318900.0AB231890.1 Triticum aestivum WFLd mRNA for FLORICAULA/LFAFY-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020152169.10.0probable transcription factor FL
SwissprotQ0JAI11e-160FL_ORYSJ; Probable transcription factor FL
TrEMBLA0A287J8960.0A0A287J896_HORVV; Uncharacterized protein
STRINGMLOC_14305.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-59floral meristem identity control protein LEAFY (LFY)