PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_14207.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family Trihelix
Protein Properties Length: 476aa    MW: 51101.2 Da    PI: 8.1464
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_14207.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix109.81.7e-34258343187
      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                   rW+k ev+aLi++r++++ r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+qlea
  MLOC_14207.2 258 RWPKTEVHALIQLRSNLDMRYQEAGPKGPLWEEISAGMRRMGYNRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLEA 343
                   8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0052255317IPR001005SANT/Myb domain
PfamPF138371.0E-23257344No hitNo description
Gene3DG3DSA:1.10.10.604.7E-4257314IPR009057Homeodomain-like
PROSITE profilePS500907.41257315IPR017877Myb-like domain
CDDcd122031.38E-30258322No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MSFSTSNTEE YSDEDDSSDD EGTDDMGGGA DERGKRKRTS EGGAAAATGG EAGSGKMMRF  60
FEGLMKQVME RQEAMQQRFL EAIEKREQDR MIREEAWRRQ EMARLAREQE ILAQERAMAA  120
TRDAAVLSFI QKITGQTIPM PSIAAQAITF MPPPPPSQPH ASPIAYSAAP VPPPPSSSQP  180
PATHSQPQPS PRQHKPPTMP PVTPQPHKSP APATPQLQQQ APAVNSSCMD IVVTPSEAPH  240
DSSGYDGSGG GSGPASSRWP KTEVHALIQL RSNLDMRYQE AGPKGPLWEE ISAGMRRMGY  300
NRSSKRCKEK WENINKYFKK VKESNKKRPE DSKTCPYFHQ LEALYRNKAA LSSPSGAGSP  360
LSLPPPAEHA NAAPQDRIEA FTVAAPISQT SPQQHAVAPV GVAKTDASNA GNGNSNGGNA  420
SEGVSGGVQR VASNGGSRFV FSEAGGNKAA KKVMCILDVA VANWHVHVVP CCSFLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3727130.0AK372713.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3010E21.
GenBankAK3615070.0AK361507.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1142F04.
GenBankAK3544260.0AK354426.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1007E05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464376.11e-131hypothetical protein SORBIDRAFT_01g017120
TrEMBLM0UU160.0M0UU16_HORVD; Uncharacterized protein
STRINGMLOC_14207.30.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.16e-51Trihelix family protein